Dataset for protein ORF115R of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MTNINFSALLRGERMCPLTREIHSQMLIVTKSYSLVETFRAFPRLPNILEIGNNIVSDGNLNWGRILILLGISQLYFTKS
                                                                                

        90       100       110       120       130       140       150  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
**************************.*********************************************
ESESERTQITEQLERFFRQDAISNWIvSNGGWVTCASLDLRNYSSVTNALQAMCFFGALFGTIAVIAYYLLP
                          a                                             
© 1998-2018