Dataset for protein iridoviridae of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*   :*                          .   . : :       :  :  :    .:         .   .:. **
MdVRQFLsDCE-------------APEEMVALRAAADAVGvDNrAcaHL--YTMLWEGvNL--------EEVHASlLgDG
 tnin sallrylidaffkeyfnsgermcpltkeihsqmlivtmsyslvetfrafprlpsitteidilvlkignnfvs  
 msnk et tk             q sndii  t kke n lfkkht     snmindi          kdtae ifr  
 g     l                                   d fr                                 

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 :****:  :: .    .    :  :  :::      : .  : :                . :    .           
vVNWGRvAaFMHICRYiVRTFPSSMDRTEVA--LTKFIQDPkIdk--------------qLREWTDRLGTVgvIGrCL--
nl    ilillgvsqltftksetesetdqiteqsertfrqdavynwivsnggwvtcaslhqknyssvtnalram----ew
l     miv itfgi y eylk inn  k     vs  issylse  a           d  h likn --q-- k    
i       s                                r i                           -l       

       170       180       190       200      
....:....|....:....|....:....|....:....|....:.
    ::*          .          *     ..:    :    
---eWLG----------A--------GVI----TGVvLSLLFs---
lerkff lvdfftvqtyvsvvtgvitft tgvi-aaiayyalylty
   c i           tgpiksllf f vfmga  m  s  p   
   a                   a a                n   
© 1998-2018