Dataset for protein iridoviridae of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*   :*                          .   . : :       :  :  :    .:         .   .:. **
MdVRQFLsDCE-------------APEEMVALRAAADAVGvDNrAcaHL--YTMLWEGvNL--------EEVHASlLgDG
 tnin sallrylidaffkeyfnsgermcpltkeihsqmlivtmsyslvetfrafprlpsitteidilvlkignnfvs  
 msnk et tk             q sndii  t kke n lfkkht     snmindi          kdtae ifr  
 g     l                                   d fr                                 

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 :****:  :: .    .    .  .  . *.::  :  :: :                    :. ::.           
vVNWGRvAaFMHICRYiV---RTFPSSMDRTEVA--LTKFIQDPkIdk--------------qLREWTDRLGTVgvIGrC
nl    ilillgvsqltfeyltksenesei qiteqieryfrqdavynwivsnggwvtcaslhvqnyssvtnalram---
l     miv itfgi y    k in tdk  s sti ss liehrkswl kn awiglvdffd  t   pv---q-- ks
i       s                                   q he  a           t           -l    

       170       180       190      
....:....|....:....|....:....|....:.
       ::*.        *.:              
L-----eWLGA--------GVI----tGVvLSLLFs
-lwlfrkff vgvitgvit tmtgvi-asiayytly
 etfeic m t     alf a     ly afn  yp
      v           a       a        -
© 1998-2019