Dataset for protein 097R of organism Frog virus 3

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVHASLLGDGVVNWGRVAAFMHICRYIVRTFPS
                                                                                

        90       100       110       120       130       
....:....|....:....|....:....|....:....|....:....|....:..
*********************************:********************** 
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVGvIGRCLEWLGAGVITGVVLSLLFy
                                 l                      s
© 1998-2018