Dataset for protein 097R of organism Ambystoma tigrinum virus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
******* ***********************************:************************************
MDVRQFLsDCEAPEEMVALRAAADAVGVDNMACAHLYTMLWEGvNLEEVHASFLGDGVVNWGRVAAFMHICRYTVRTFPS
       l                                   i                                    

        90       100       110       120       130       
....:....|....:....|....:....|....:....|....:....|....:..
*********************************************************
SMDRTEVALTKFIQDPKIYKHLREWTDRLGTVGVIGRCLKWLGAGVITGVVLSLLFS
                                                         
© 1998-2018