Dataset for protein herpesviridae of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------maystreillalcirdsrvhgngtlhpvlelaaretplrlspedtvvlryhvlle-----
mnlaialdsphpglasytil----------------e-mrpakstds-fvrtpv-awvap--pr----------dihmey
 srffvvwywvnyitkvcsgprpfyhiskkpvswpt-t---s-----l------d----vltmvrllvecgmgrl   ll
            mveagilsevvipsvlwfqyhsdmlhepy-nlkentitmseqtmdpv-vsingfscylnkti      
                    rk t gdh tfftmq kmlgmphkcsgiyyapsisslestaikapd  shaf        
                          s      p  gkkyagew k avwy llneffkk fr      f a        
                                        qclg a    f f     li  n                 
                                        e df              c   g                 
                                           a                                    
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------eiiernsetftetwnrfithteh-dldfnsvfleifhrgdpslgralawmawcmhacrtlccnqst
lehpvtapikvavqkvarssylmlramyavi-srddkvtpplpalvvcrlikaslrkdkkv-yael-------adiggkd
iksgipcsyakgimdlkptkadlcsdfftncnlnegll--ghaittandy--pr nrrfvscffdssvyvvqp-------
 d            selcetqviienylei lagv--ey esleaiel-rft-e tmeerpmglrflf  mlavarrkpl
              radvqevaa vgvsqh g-v-pnps ----r--kk-yitt ew  er li y     k nvkfhyh
              q t gdg v asi ma vn-kae p y st-sp-t aaeg mq  l  hy a     a   vdtnq
                  vre e   q kt sds  a e    l a is  n x k   g               s  tc
                  k   d     d   cq  t      r           h                   g    
                                    g                                           
                                    d                                           

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
p--------------------------------------------------yyvvdlsvrgmleasegld----------
thvrliisvlravyndhydywsrlrvvlftslfvdvinsgrivgffdvgrycctlvfatknyvddhksa-esmthafvlg
-visqlglsmlqlsgpggmn g alaii                       vfggsifqglttqplnv-pdciiesriaa
lglqi q  ysedndganl  k d st                        rlcsfvcpaawnn-clegn     fhlen
aa na    v   es slk    c  l                        t eekst evse-g--rki     d av 
         a        f       k                        a aq n   sl-r  yl            
                                                     qi     kff    -            
                                                     l             k            
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------gWihqqGGwstlie---------dnipgsrrfswt------lflagltlsllvics----ylfisr-r
aiahylalyrrplafarl-kmprslrchffprfck------pqspvlklpsafwamtsiadfvksl--arnm------g-
vlpnhfyeeqgfn qrehr-lkg-as  ivgwygtvvnsprqtrrf-      flflaasglittvavlva vhvtrvtw
n mv ap aii q llkek --af-k      tlsqrltrt-s-gmr      ip gevgigapi ga    lamsyqak
   a     d  p tgar   r-vk-        gp s qpsgt--d      a- r  vsvfar yl    gwrvt   
            e nesf   dqpva         g p k k-  na      yv h   kc  l lf     n c    
            f  dhm    eifp           d   cn           k f   f   g        i      
                        c                                                f      
                                                                                
                                                                                

 
.
 
-
h
q
 
 
 
 
 
 
 
© 1998-2019