Dataset for protein herpesviridae of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------------maystreillalcirdsrvhgng-----alhp
mnlaialdsphpglasytilprpfyhislkpvswpdetmrpakstdsvfvrtpv-awv-psppfdklaessylmfrtmya
  r              mveagilsrkvttgsh mslffvvwywvnyi------d---p---kveyhsdgehepledyfk
                                  tff pqmshkksgttkvcsgtvyiksvlm-qsmlptdvflysnvce
                                        tl  gaclywagliylfp tms-rgefkcetsavingisq
                                        q       w k a  fp    m amd d vpa aevstrm
                                                                kh y   l y  i  y
                                                                 a n   e k  f   
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
vl-elaaretp----------------lr------vvlryhvlleeiiernsetftet---fithtehgdldfn-----s
nfitrdekdldevvstirrllvecgmgpplspedt-aavlcraikaslrkdrklyanlwnracrtadivgkgthvrliih
icga---q-m-                -eeylnhpst--ikkrvqdvrktkqdslsdsltn-nsvealltp---esilk-
himlmes-y-y                ssvlrggfl-sp-l-----tatqrkrihfrffevimlpv-re--ealiqqagr
ah -gtptgsf                h- i d   l sp-liyite m eevpsysa dt ----vnphstsalna ql
s  cnklspp                 fi       c aeiagaarg v gf acgq     lknng--eth g     t
    qike i                 cc         haa   mqa    a r        vaal vfs q s      
       n                                    d      l d        sny  s            
       g                                             c         ds  d            
                                                                g  a            

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                   .                                                            
vfleifhrgdpswgRalawlawc------------------------mhAcrtlccnqstp------yyvvdlsvrgmle
alravyndhydyls lrvvmcytvfvdvinsgrivgffdvgryvceevfvvqnylddhksavdcmthafllgaiahylal
littlndypsmnmk vvcgivfsg                       llcqglvterkellp     rccaanltnatvq
smvq--g--rlt   g sffttgs                       fy-pkssnkqcp--n     srienifpvkfy-
iyapds-pagkh   d mi flal                       -vy-a-wenp--eg      f arkvymaiasi
 vs  esnsnf    c  t   -                        s- t-i----tyr       d fq hakkhep 
 ae    gel        l   l                           l   stg nc       v       e  f 
                  k                                    s  l                     
                                                       g  d                     
                                                                                

       250       260       270       280       290       300       310     
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:
                                                                           
asegl--WihqqGGwstlie---------dnipgsrrfswt------lflagltlsllvics----ylfisr---
yrr-ndgafarl-kmprslrchffprfck------pqspvlklpsafwamtsiadfvksl--arnm------grh
elgvqvp qrehr-lkg-as  ivgwygtvvnsprqtrrf-      flflaasglittvavlva vhvtrvtwq
-qnpi   llkek --af-k      tlsqrltrt-s-gmr      ip gevgigapi ga    lamsyqak 
ii-fe   tgar   r-vk-        gp s qpsgt--d      a- r  vsvfar yl    gwrvt    
 dih-   nesf   dqpva         g p k k-  na      yv h   kc  l lf     n c     
 -a      dhm   teifp           d   cn           k f   f   g        i       
 e                c                                                f       
                                                                           
                                                                           
© 1998-2019