Dataset for protein herpesviridae of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------maystreillalcirdsrvhgngtlhpvlelaaretplrlspedtvvlryhvlle
mnlaialdsphpglasytilprpfy-------------m-pakstdsvfvrtpv-awvaps-pddkvaessysmframya
  r  t  fh  mslffvvwywvnshislkpvswpdet-l--------------n------tmaeqlmpeesilledyfv
                 m eagil itkvcsgevyipsvqkfqyysgtehegystfcsnliskvvedkcgdaatinrvsq
                 i       rkvt gdl tff pkmlhkkadlswa liy flksmkfsgdflfvtndvaygirm
                           h  fsh       tgy gtcdykk a   tevtvh lkl d pll a vsfik
                                n       q e r  aw   i   pps l  c a n k r y dft n
                                        a       g        k     p   g y      l   
                                                a        t     h                
                                                v                               
                                                i                               
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                        :                                                   .   
ei----------------------iernsetftetwnrfithtehvdld-----fnsvfleifhrgdpslgRalawmawc
vfgtrdekdlplpalvlcrlikaslrkdrklyadl---acrtadiggk-thvrliirilravyndhydywsglrvvl---
ic mglpeyplhrvtapikvavqdviqtkrsifssflt-ensvadletpapesqlghaattlndppsmnmkcvvcgiffs
hl anegtliyiktaselsryitimtereqdlyrnssqn-lp--s---tegiqi-e-sivqdsgyr-ltr  g sff tl
ah lqkagpaesalgis  yvale maefdrhvnclgs mvinvrfhshsalna -l mks etnagkh   d miv yg
qv c s fm dt sqfv  h tgt v antpgl a dg l--ln-r hq  aav sk yam  sgsnfr   c tt    
fr s g st  n nmr       g k qa aas   v  tknsgna ar      qa vsd  aeelq    t  l    
       rg                d    k     q   aae v  r       t   e      c        k    
       a                 q          e   g   g  p       r   h               r    
                                            e          k   f                    
                                                       a                        
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
mhacrtlc-nq-tp------yyvvdlsvrgmleasegld----------------------gWihqqGGwstlie-----
--------c--s--vdvgrycctlvfatknyvddhksa-esmthafvlgaiahylalyrrplafarl-kmprslrchffp
vyvvqivskrkpllf     vfggsifqglteqplnv-pdciiesriaavlpnhfyeeqgfntqrehr-lkg-asagivg
lfgdvrnrgdiygf      rlcsfvcpaswtnlclegnmyacqfhlenntmv apkaii q llkek --af-k  mse
f   wa  y tvc       t eeystknasnrg--rki g  cdkave  va  s  dt p tgar   r-vk-    a
    a   r pn        a ait qa vffkqnylca     g      t         e nesf   dqpva     
        f  d          qal     qrse r-                        f mdhm   veifp     
                      l c     a a  dk                        v  t n   tstc      
                                                             i    i      y      
                                                             d                  
                                                             c                  
                                                             a                  

       250       260       270       280       290
....:....|....:....|....:....|....:....|....:....|
                                                  
----dnipgsrrfswt------lflagltlsllvics----ylfisr-r-
rfck------pqspvlklpsafwamtsiadfvksl--arnm------g-h
wygtvvnsprqtrrf-      flflaasglittvavlva vhvtrvtwq
stlsqrltrt-s-gmr      ip-gevgigapi-ga    lamsyqaks
 sdgppsyqpsgt--d      a-vr--vsvfar yl    gwrvts  g
 h pglplkyk-vina      yvihi -kc--l lf     nqcq    
   hsddeancnm ls      rk f  cf-  g i      ilf     
    n gd etkl ag       i -   -a  -        fa      
      fa  heh            s   y            d       
      a   e                  r                    
                                                  
                                                  
© 1998-2019