Dataset for protein herpesviridae of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------maystreillalcirdsrvhgngtlhpvlelaaretplrlspedtvvlryhvlle
mnlaialdsphpglasytvlprpfy-------------m-pakstdsvfvrtpv-awvaps-pddkvaessysmframya
            mslffviwywvnshislkpvswpdet-l--------------n------tmaeqlmpeesilledyfv
                 m eagil itkvcsgevyipsvqkfqyysgtehegystfclnliskvvedkcgdaatinrvsq
                 i       rkvt gdl tff pkmlhkkadlswa liy feksmkfsgdflfvtndvaygirm
                           h  fsh       tgy gtcdykk a   tsvtvh lkl d pll a vsfik
                                n       q e r  aw   i   pps    p a n k r y dft n
                                        a       g        k     h   g y      l   
                                                a              c                
                                                v                               
                                                i                               

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                        :                                                   .   
ei----------------------iernsetftetwnrfithtehvdld-----fnsvfleifhrgdpslgRalawmawc
vfgtrdekdlplpalvlcrlikaslrkdrklyadl---acrtadiggk-thvrliirilravyndhydywsglrvvl---
ic mglpeyplhrvtapikvavqdviqtkrsifssflt-ensvadletpapesqlghaattlndppsmnmkcvvcgiffs
hl lnegtliyiktaselsryitimtereqdlyrnssqn-lp--s---tegiqa-e-sivqdsgyr-ltr  g sff tl
ah cqkagpaesalgis  yvale maefdrhvnclgs mvinvrfhshsalnv -l mks etnagkh   d miv yg
qv a s fm dt sqfv  h tgt v antpgl a dg l--ln-r hq  aai sk yam  sgsnfr   c tt    
fr s g st  n nmr       g k qa aas   v   kns na ar      qa vsd  aeelq    t  l    
       rg                d    k     q   aae g  r       t   e      c        k    
       a                 q          e   g   v  p       r   h               r    
                                            e          k   f                    
                                                       a                        

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
mhacrtlccnq-tp------yyvvdlsvrgmleasegld----------------------gWihqqGGwstlie-----
-----------s--vdvgrycctlvfatknyvddhksa-esiieafvlgaiahylalyrrplhfarldkmprslrchffp
vyvvqivskrkpllf     vfggsifqglteqpl---pmgaccdrlaavltvffyeeqgmnylleerilkaqakagivg
lfgdvrnrgdiygf      rlcsfvcpaswtnlcnvgi     slanecmpa aiknnl q trlhktfrgfks  mse
f   wa  y tvc       t eeystknasnrg-leka     ehivdytvq    ai  e npar   dqvva    a
    a   r pn        a ait qa vffkqnyrc      gk      n        p mgsm   leprp     
        f  d          qal     qrse rk                        f  ehn   vsif      
                      l c     a a                            v  d i   t tc      
                                                             i  s     c  y      
                                                             d           t      
                                                             a                  

       250       260       270       280       290
....:....|....:....|....:....|....:....|....:....|
                                                  
----dnipgsrrfswt------lflagltlsllvics----ylfisr-r-
rfck------pqspvlklpsafwamtsiadfvksl--arnm------g-h
wygtvvnsprqtrrf-      flflaasglittvavlva vhvtrvtws
stlsqrltrf-s-gmr      ip-gevgigapi-ga    lamsyqakq
 sdgppsyqtsgt--d      a-vr--vsvfar yl    gwrvts  g
 h pglplkpk-vina      yvihi -kc--l lf     nqcq    
   hsddeancnm ls      rk f  cf-  g i      ilf     
    n gd etkl ag       i -   -a  -        fa      
      aa  heh            s   y            d       
          e                  r                    
                                                  
© 1998-2018