Dataset for protein BALF1 of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                      *. :: **:***.*******:* ****.***:***:******
mnlaialdsphpglasytilprpfyhislkpvswpdet kqtet  a   k       s l    r   t   l      
  r  t  fh                      n       a  c                                    

        90       100       110       120       130       140       150       160
**:.**..** ** ****  ** *.**. **::***.***: .. :**.:* *:***:*:** ************:****
  aq  tn  t  q    xx  x k  kr  td   k   vrdrha  qi t i   l d  c            a    
  s   sg     m              e                                                   

       170       180       190       200       210       220
*****:** ******** ********* **.*:**:****. **** *::*.*: *****
     n  e        t         v  v m  l    kc    r tm g sy     
        r                  p    i                i          
© 1998-2019