Dataset for protein BALF1 of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                      *. *:***:***.*******:* ********:***:******
mnlaialdsphpglasytilprpfyhislkpvswpdetMRPAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYA
-------------------------------------- kq e   a   k       s l        t   l      
  r  t  fh                      n       a                                       
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**:.**..** ** ****  ** *.**. **::***.***: .. :**.:* *:***:*:** ************:****
VFtRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFA
  aq  tn  t  q    xx  x k  kr  td   k   vrdrha  qi t i   l d  c            a    
  s   sg     m              e                                                   
             a                                                                  

       170       180       190       200       210       220
....:....|....:....|....:....|....:....|....:....|....:....|
*****:** ******** ********* ****:**:****. **** **:*.*: *****
VRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSLRRQFPVTWALASLTDFLKSL
     n  e        t         v    m  l    kc    r  m g sy     
        r                  p    i                i          
                           i                                
© 1998-2019