Dataset for protein BALF1 of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                      *. *:*******.*******:**********:***:******
--------------------------------------MRpAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYA
mnlaialdsphpglasytilprpfyhislkpvswpdet kq e       k       s          t   l      
                                n       a                                       
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**:.**..** ** **********.**..***:***.***: .. :**.:* *:*****:** ************:****
VFTRDEkDLPLPAlVLCRLIKASLRKDRKLYAELACrTADIGGKdtHVrLIISVLRAVYnDHYDYWSRLRVVLCYTVVFA
  sq  tg  t  q          k  kr   d   k   vrdrha  qi t i     d  c            a    
  a        m                                                                  
             a                                                                  

       170       180       190       200       210       220
....:....|....:....|....:....|....:....|....:....|....:....|
*****:** ******** *********:****:**:****. **** **:*.*: *****
VRNYLDDHkSAAFVLGAIAHYLALYRRLWFARlGGMPRSLRRQFPVTWALASLTDFLKSL
     n  e        t         v    m  l    kc    r  m g sy     
        r                  i    i                i          
                                                            
© 1998-2018