Dataset for protein A9 of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                          .*     *:: ::**:.* .*:.::**..*:.**:** 
mveagilsrkvttgshwtfftpqtlkkgaclwkagavyfppvk lgeka kdgdi  fn ln ifli  kn fp  h  g

        90       100       110       120       130       140       150       160
*:  :*...::**. **** :.*  *.*********:******:***:* *:*** *** .**:*:*:.** **::.*::
 ldaa kkald  gq    sdg ea e         s      h   l a f   a   in  e l fn  l  ieq ie

       170       180       190       200       210 
.*******. *. *    **  *: ... *:*:.** :::**:  *:    
a       gp dl pkqe  dl lpeafi f aa  clal  fcf atstk
© 1998-2019