Dataset for protein A9 of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                          .*     *:: ::**:.* .*:.::**..*:.**:** 
-----------------------------------------msMpprpeFne-nlLYysFtrElhmlLIrsGisCSyAKl
mveagilsrkvttgshwtfftpqtlkkgaclwkagavyfppvk lgeka kdgdi  fn ln ifli  kn fp  h  g
                                         a                                      

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*:  :*...::**. **** :.*  *.*********:******:***:* *:*** *** .**:*:*:.** **::.*::
ImretRtrgveCSstFEVIvnsVghPsPESLERIAKtLFTPRPnWGRvVmFlAYLfYLQksSTqKvFwrDHyKKlksIvk
 ldaa kkald  gq    sdg ea e         s      h   l a f   a   in  e l fn  l  ieq ie
                                                                                

       170       180       190       200       210 
....:....|....:....|....:....|....:....|....:....|.
.*******. *. *    **  *: ... *:*:.** :::**:  *:    
cHIVPWTLsqRkpK---rPFp-KmrsvvyFlTtvASlvtmLLlyrRtwq--
a       gp dl pkqe  dl lpeafi f aa  clal  fcf atstk
                                                g  
© 1998-2018