Dataset for protein herpesviridae of organism Ovine gammaherpesvirus 2

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*****************************************.**************************************
MVEAGILSRKVTTGSHWTFFTPQTLKKGACLWKAGAVYFPPvSMPPRKAFNDGDLLYFNFTREIHMLLIKSGIPCSYAKG
                                         a                                      

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
IMRAARTKAVDCSSTFEVIVDGVGHPSPESLERIAKSLFTPRPNWGRVVMFFAYLFYLQISSTQKVFFRDHYKKIESIIE
                                                                                

       170       180       190       200      
....:....|....:....|....:....|....:....|....:.
***************************************:*****.
AHIVPWTLSQRKLKEPFPLKMREVVIFFTTVASLVAMLLlCRRAWs
                                       f     g
© 1998-2018