Dataset for protein vNR13 of organism Meleagrid herpesvirus 1

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MADSLKEETALLLEDYFQHCCGKEGPPPSPTAAELRRAAAELERRERPFFRSCAPLASGGTQAALSALQSVVSELNSGSG
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
****************************************************** . .*  : . **. :.  *: .   
FNWGRCLATIVLGGSLATALYENGCEEGPSRLAAALAAYLAEEQGEWLREHGGWvstcR--msgsFGspvserSqthrlr
                                                      dgfa agffar  pglgaa eefpag

       170       180 
....:....|....:....|.
                *    
r---------------W----
livaaagigitvlivv qfqs
© 1998-2018