Dataset for protein herpesviridae of organism Epstein Barr virus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                      :.      .*:  :. *:     * *          ::: * 
--------------------maystreillalcirdsrvhgngtlhpVlelaarEtplrlSPeDtvvlryhvlleeiiEr
mnlaialdsphpglasytilprpfyhis-kpvswp-etmrpakstds fvrtpv awvapl p ----------dkva s
  r  t  fh          -------- ------ --  q aa  a   k s  slpcv                    
                      h   d     n          v        t   h h                     
                                           i                                    

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.   *   :  *       :* : ::..    ..    .  *    :   **.        .:                 
nsetFtetwnrFithteh-DLdfnsvfLeifhrgdpslgRaLawmawcmhACRTlccnqstpy-----------------
sylm ramyav trdek-vn plpalvvcrlikaslrkdck ----yael  wradiggkdthvrliisvlravyndhyd
  d  s   ds a y gnl      i f  xx  x  r  t t l  tdy   a  vrpy     i       l      
            l   d                       r      g        y dd                    
                a                       e               f                       

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
          *.* ::**. *:  :.                  *: . ** .  :  ::*    . *:*     ** .*
----------YvVdlsVRgmLeasegld---------------gWihqqGGwstliedniPgsrrfsWtL-----FLagL
ywsrlrvvlc t vfa  ny ddhksaafvlgaiahylalyrrl farl  mprslrrqf ----vt a asltd  ks 
                     n                     p            kc    y s i             
                                           i             n      k               
                                                                                

       250        
....:....|....:...
                  
tlsllvicsylfisrgrh
------------------
      v          q
                  
                  
© 1998-2019