Dataset for protein herpesviridae of organism Epstein Barr virus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                      :.      .*:  :. *:     * *          : : * 
--------------------maystreillalcirdsrvhgngtlhpVlelaarEtplrlSPeDtvvlryhvlleeiiEr
mnlaialdsphpglasytilprpfyhis-kpvswp-etmrpakstds fvrtpv awvapl p ----------dkva s
  r  t  fh          -------- ------ --  qtaa  a   k s  slpcv     i         r    
                      h   d     n          v        t   h h                     
                                           i                                    
                                           c                                    

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.   *   :  *       :* : ::..    ..    .  *    :   **.        .:                 
nsetFtetwnrFithteh-DLdfnsvfLeifhrgdpslgRaLawmawcmhACRTlccnqstpy-----------------
sylm ramyav trdek-vn plpalvvcrlikaslrkdck ----yael  wradiggkdthvrliisvlravyndhyd
  d  s   ds a y tnl      i f  xx  x  r  t t l  tdy   a  vrpy     i   i   l      
            m   g m                     r      g        y dd                    
            l   d                       e               s  c                    
                a                                       f                       

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
          *.* ::**. *:  :.                  *: . ** .  :         *  *  **.**  * 
----------YvVdlsVRgmLeasegld---------------gWihqqGGwstliednipgsRrFswTlfLAgLTlsLl
ywsrlrvvlc t vfa  ny ddhksaafvlgaiahylalyrrl farl  mprslr------cq pv wa  s  df k
                     n                     p  v     t   kn f  y s   t         
                                           i                    k               
                                                                                
                                                                                

       250   
....:....|...
 :           
vicsylfisrgrh
sl-----------
 v          q
             
             
             
© 1998-2019