Dataset for protein herpesviridae of organism Epstein Barr virus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                      :.      .*:  :. *:     * *          ::: * 
mnlaialdsphpglasytilprpfyhis-kpvswp-etmrpakstds fvrtpv awvapl p ----------dkva s
  r  t  fh          -------- ------ --  q aa      k s  shphv                    
                      h   d     n          v        t     c                     

        90       100       110       120       130       140       150       160
.   *   :  *       ** : ::..  : ...   .  *    :   **.        .:                 
sylm ramyav trdek-v  plpalvvcrlikaslrkdck ----yael  wradiggkdthvrliisvlravyndhyd
  d  s   ds a   gnl      i f         r  t t l  tdy   a  vrpy     i       l      
            l   d                       r      g        y dd                    
                a                       e               f                       

       170       180       190       200       210       220       230       240
          *.* ::**. *:  :.                  *: . ** .  :  ::*    . *:*     ** .*
ywsrlrvvlc t vfa  ny ddhksaafvlgaiahylalyrrl farl  mprslrrqf ----vt a asltd  ks 
                     n                     p            kc    y s i             
                                           i             n      k               

      v          q
© 1998-2019