Dataset for protein herpesviridae of organism Epstein Barr virus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                :. :. :  :* .  *..*  ..      ::.
------------------------------------------------maystrEillAlcirDsrVhgng-----tlhp
mnlaialdsphpglasytilprpfyhislkpvswpdetmrpakstdsvfvrtpvdawv pspp dk aessylmframya
                                n       q         k                   a     s   
                                                  h                         v   
                                                                            i   

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*:    .:           .*    *::  : .:   :::             *.  :   :.::: : :          
VlelaaretPLrlspedtvvLryhvLleeiiernsetftEtwnRfi------THtehvdldfnsVfleifhrgdpslgra
 ftrdekdlhpp-------a vlcr ikaslrkdrklyadlacstadiggkdr vrliisvlraiyndhydy--------
  a  s     hvl                     r  s   d    vrd     dnl        v        rr ct
                                   d                   ai         f             
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  *    :  *           *.* ::**. *:  :.                  *: . ** .  :  ::*    . *
laWmawcmhaCrtlccnqstpyYvVdlsVRgmLeasegld---------------gWihqqGGwstliedniPgsrrfsW
-- srlrvvl ----------- t vfa  ny ddhksaafvlgaiahylalyrrl farl  mprslrrqf ----vt 
 t l  g  wr  y py              n                     i            kc      s i 
            a  f  d                                                  n      k   
                                                                                

       250       260       270
....:....|....:....|....:....|
:*     ** .*                  
tL-----FLagLtlsllvicsylfisrgrh
a asltd  ks ------------------
                  v          q
                              
                              
© 1998-2018