Dataset for protein BALF1 of organism Epstein Barr virus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                      ** *********.********* *******************
mnlaialdsphpglasytilprpfyhislkpvswpdetMRPAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYA
--------------------------------------  q         k         l                   
  r  t  fh                      n                                               

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**:************************* **::*******: .******:*******:**********************
VFtRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFA
  a                         r  td       vrd      i       l                      
                            e                                                   

       170       180       190       200       210       220
....:....|....:....|....:....|....:....|....:....|....:....|
*****:********************* ************. ******************
VRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSLRRQFPVTWALASLTDFLKSL
     n                     p            kc                  
                           i                                
© 1998-2018