Dataset for protein BALF1 of organism Epstein Barr virus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                      ** :* **:***.********* ****.**************
mn-aialdsphpglasytilprpfyhislkpvswpdetMRPAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYA
--l-----------------------------------  qt t  a   k         l    r              
  r  t  fh                      n          c                                    

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**:***.:**********  ** ***** **::*******: .******:***:***:**********************
VFtRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFA
  a   tn          xx  x     r  td       vrd      i   i   l                      
                            e                                                   

       170       180       190       200       210       220
....:....|....:....|....:....|....:....|....:....|....:....|
*****:********************* **.*********. ******:***********
VRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSLRRQFPVTWALASLTDFLKSL
     n                     p  v         kc      t           
                           i                                
© 1998-2019