Dataset for protein BHRF1 of organism Cercopithecine herpesvirus 12

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*********************************************************************  *********
MAYSTRDLLLALCMRDGHVYGGDGLHPVLELTARESPFSVSPGDPLVLRLHALLEQIIVQNEDAFAETLvtFLLNTEDLD
                                                                     dr         

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
LDFSRVFAEIFHNEDPTLGRGLAWLAWCMHACRTLCGDTNCPYYVVDLAVRGMLEASEGLDGWIGQHGGWPAVLRGNPSG
                                                                                

       170       180       190
....:....|....:....|....:....|
******************************
TRSSRWTIVFTGLTLSLLVVCSYIFISRRH
                              
© 1998-2018