Dataset for protein herpesviridae of organism Bovine herpesvirus 4

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*****:************ **************************:********************************:*
MSLFFvVWYWVNYITKVCsGEVYIPSVLKFQYHSDTEHEPYSNLCeNLITMAEQDMDEVVSTIRRLLVECGMGLEEYLeH
     i            f                          k                                d 

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
PVTAPIKVAVQDVIRTKQDIFSNFLTNINSVEDLETLGHAITTLNDYPSPNMGRVVCGIAFSVYVVQTVCKRKPLLVRCC
                                                                                

       170       180       190       200       210       220      
....:....|....:....|....:....|....:....|....:....|....:....|....:.
**********************************************:*******************
LDIFTRATVQALNVNWFLQEGGWPALASFCKVVNSPSPRSRWLFPMlAISGLVLTVGVARNMVHFT
                                              f                   
© 1998-2018