Dataset for protein adenoviridae of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                  . ::                      :   
-------------------------------------MevwtiLedfsktRrLlEdsSdgcSgfWRfwfGtplsrlVyrv
       mindvnfvclfkgdklggikgmgsestafl dllac aelrsv qvvqnacnrt wlk hlwastqakvlfti
        mfnmthgrglvlyywqhlgtaavtlghat  arev qtynql n   lc asv ycg lc  gd cnficqa
           lhg lnga l gyimrrgvqrfred   iese rs ea  l   qt eka sw  yi  cs ts  r t
                            wlplaaf    fygn gn qv  c   e  kns ri  wf   e     h  
                              i v       dvd s  dn  k   y      k        r     v  
                                         rs    h       t      f              n  
                                         kl    y       s                        
                                          a    g                                
                                               k                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
: .        .                                               .*                   
KkdykeeFenlladcpg-lfdsLnlGHqslFqekvlhsLDFssPGRttAavAFvvfilDkWs-qqthlSrgYiLDfaamh
 qeqswq akifkesse vlea dfcyhahlkqriikv t ttt  aasgi  ltylv q inedsqftwd vm ylsaa
 e hnsr de vsstg  i v  e   rtv ndilvsa v e s  lvvsl  iatvk r n re    ge t  citlq
 r  rtd sr  dtnq    a       vf e s srt   c    vc  a  fsh f     sn    k  m   m vc
 l  ea   d  vfv             ky y   fpn         i     ac        pr    p  l   t ts
    qv   h  rql                     cq               c         ag    e  q   v  n
    lq   g  eni                      g                         t        r       
     k       h                       e                         k                
     d                                                                          
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
LWRawvr---qrgqrilnywllqp-aapgllrlhrqtsmleee-----------eamde----------------npRaG
  ktvla   rk-----grlpvlslgvaaivphee--------mreearrrrrqqqqed            qspwal-s-
   fmkc   hgmrtvsdgsra-rpvrlrrie-ppempavlqqqqqaqqqeeqepeepw                -- - 
   sliv   --lnayi-cc-is srgrdp-ht-qteeqqqrkpevqgagqaer-ds--                pm   
    gmk   k vyvccrtve-r ql---ss-eq-vqqsprvrrl  ese  s l--tp                e    
    yr      rknhpil  yh vdtdpvpsansadklrd  ek  r      vgrqk                t    
              laga-  rn  hlsq- qrrvis ee   dp  i      rmarq                     
                ks       - mea l llpn ts              gr                        
                         t qv  v   gp h                                         
                                      g                                         

       250       
....:....|....:..
                 
LDPpsEe----------
---rv--eld       
v a--adaee       
m tqttln n       
   va            
   tl            
   se            
                 
                 
                 
© 1998-2019