Dataset for protein adenoviridae of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                                . ::                      :   : 
     mindvnfvclfkgdylggikgmgsestafl dllae aelrsv qvvqnacnrt wlk hlwastqakvlfti q
         mthgrglvlykwqhlgtaavrlghat  irgv qtynql l   lc esv ywg lc  gd cnfirqa e
                          rvqtfre    aeec rs ev  n   qt aka rc  yi  cs ts  c t r
                                     fysn gn qa  c   e  kns si  wf   e     h   l
                                      dvd s  dn  k   y      k        r     v    
                                       rs    h       t      f                   
                                       kl    g       s                          
                                        a    y                                  

        90       100       110       120       130       140       150       160
.        .     :.                                         *                     
eqssq akifdessevle a dfcyhahlkqriikv t ttt  aasgi  ltylv r inrdsqftwd vm yisaa  
 hnwr dr vsstg i v   e   rtv ndilvsa v e s  lvvsa  iatvk q n se    ke t  cltlq  
  rtd se  ktnq   a        vf e s srn   c     c  l  ash f     en    p  m   m vc  
  ea   d  vqv             ky y   fpt         i     fc        pr    g  q   t ts  
  qv   h  rnl                     cq               c         ag    e  l   v  n  
  lq   g  efi                      g                         t        r         
   k       h                       e                         k                  

       170       180       190       200       210       220       230       240
ktmkaq         k--tvsgrlpvlslgvaaivphpe--p-----mreaqreerqeqqqed-l               
 fvvch         gmr-y-dgsra-rprglrrie-epem-avlqqqeagrqrrqe pee-wa-               
 slivk         -lna-ircc--s sl-rdsshe-qteepeqkpevqqegqqe  -d-tpem               
  gmk           vyvcc-tveir qvrd-p--tq-vqqsqvrrlq iae  s  l-sp-t                
  yr            rknapil  rh vdl-pvpsanvadlerr vrp es      vgaqk                 
                  l ga-  y   htsq- qrrlssrq d d l         gmr q                 
                             - qea l lsingl                   g                 
                             t m   v   pp t                                     
                                   a   g  h                                     

       250       260
 - vnt--adaee       
   m  qttln n       
      ta k          
© 1998-2019