Dataset for protein adenoviridae of organism Human mastadenovirus D

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mepghpteqglhpglrshapvegldqaagtenlellastasssgsssstqtnihvmtrnrglvlykwqhrptpsvtrreg
                                                       gghgeaghgrepeelggwaqgfgaf
                                                                        r       
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  :* ::  ::.:     :* :  : *** .                                 *: . .:*    .  :
-MdVWtILadFsK-----TRRLVEDSSDGCS---------------------------------GFWRHWFGTPLSRLVY
lne sslygelnqvltsma gvkrer   gntgmmteltaslmnrkrperltwyelqqecrdel lmqdky leqikthw
  q a   p                                         i  h         i        s  a    
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 . .:*:.* :::     :  **. :: .::*: * . :.    * *: :** ::                         
-TVKKDYnEEFEN-----lFaDCSGLL-DSLNlGHQsLFQ----ERVLHSLDFSS-------------------------
lnpde wk aikkyakiairs  kyivtktv fr aayisgnga v idt  kaafrccmmgmragvmnmnsmifmnmkf
       s            p           i   c                                           
       q            v                                                           
       e                                                                        

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 * .  ** *:.       .   *    ::.*  *   :* :  . ** .: . *:   . .                  
PGRTTAGVAFVVFLVDKWSQdTqLsRgYILDFaAM--HLWraWiRQRGQRILNYWLlQPAaP------------------
n ekfn  l ma------nsnmh tgdsffg tn caev ks-vki  ckfygc mivvgvsksemsvkqcvfekcylgv
                  r q t h c           g  m        s   g   r                   
                    h                      s                                    
                                           a                                    

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                  : * . *: *: :: :.  .:                                         
----------------GLLrLHRQTSMLEEEMRqAMDeN-----------------------------------------
stegnarvrhcssletvcfh vkg as khnvvegctdermynmltcdsgvchilknihvtshprkkwpvfennllikch
                   c             k  yk                         a                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      *. ::*                                                                    
-----PRSGLDP--------------------------------------------------------------------
mhlgar gtfq yqcnfsqtklllendafsrvnlngifdmdvsvykilrydetksrvracecggrhtrmqpvaldvteel
                                                                                
                                                                                
                                                                                

       490       500  
....:....|....:....|..
               .. *: :
---------------PSEEELD
rpdhlvmactgtefsspg dtn
                      
                      
                      
© 1998-2019