Dataset for protein adenoviridae of organism Human adenovirus C serotype 1

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                     :::*                           * .:: *::  :
-----------------------------------qrklvC---------------------------HqgvitEkvikt
meawecledfsavrnlleqssnstswfwrflwgssmahii rikedykwefeellkscgelfdslnlg galfq emaas

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                            * .  : :.*.::*  :  .:.*   * . :. .::.               
----------------------------LsgqyllevLcmnLwrsvvrnrNrqlLpsvvrwclls---------------
ldfstpgraaaavaflsfikdkwseeth ldgliedf alh slapsqhk lld lgslkpaiipteeqqqqqqqqeear

       170       180
....:....|....:....|
                    
--------------------
rrrrqeqspwnpragldpre
© 1998-2018