Dataset for protein adenoviridae of organism Human adenovirus B serotype 3

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*************.******************************************************************
MEVWAILEDLRQTrLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
             k                                                                  

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPTMPAVLQ
                                                                                

       170        
....:....|....:...
******************
EEQQEDNPRAGLDPPVEE
                  
© 1998-2018