Dataset for protein Mcl-1 of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------lnlycgga---------------glgagsg-gatppg--------ea-a--
      mfg lkrnavigkqr s  flip--------ymmlatttgvmnyli-pqn-v-e---h--grllatek--s-rr
      sas fq qsi r           msimnmintatknnaqtalgcylf---v-vnspm-ydeqtvyagasgtssp
        a mr     a           fqmissapqtktpvsfctvmsfvlsapsgldptssssapspdsattpdvva
        n vm                 cdfppltkrsarkrnkamtsemrifpqpfsscqlrqasvpysvsrasnttq
                              m vlkkrslsyrlqlvspiaimvvdcaqtgtlgdkrrsgwpptpqkllql
                                stingappssppepqsfngfsnst lepmsaagc e shfdmprapat
                                lqqsslnnamfmsslfvmcstrns aatlnygch   c   ekeprls
                                   rqf  ftalprracdnnnmml pwkygplte        g vni 
                                   pt    giimqk aw gchhg eqarvnkr           eqc 
                                    l     gdgn   t  mg e ci ndkqf           kmp 
                                             l      a  d  k hwv a           iif 
                                             k              aih d           hgd 
                                             h               f               c  

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
e-ggg-------g-------------spp--l----r-------------------------------------------
-i---eagdvig-sage   gsneta---an-tpda-rvarpppigaevpdvtatparllffaptrraapleemeapaad
qvamsssiaslnsnvva    psdapkrskapavnstngvprs vagpgsnlsgsapkrflleigllvsrpvklagsisa
rapaaatltphhaips     vdgskrarstfgttgskepgga r sglrphatpwsgpqrksapcctggsgavpswvp 
iltvkglkehsdlpla     gtaqqpkqtdwemstlgsi  g     daa ipigeasayal  yscvcra q klr  
anstrtvvgerletsd     lgpnsgs dsvqarpavp         a     d t a hr   dn l e    dgg  
pglipdpsmanvfmge     kesfmlg nl vlvqkpl               a g         d e       a   
mfksh kecddtwyyt     tanylv  qr degmfa                                          
vrelt rpr er dtl     iq rtq  lk s lkp                                           
s hf  im  qp  i      eh ge   re l e n                                           
      gt  ck         ac v    gv r p g                                           
      f   vi         w        p p m                                             
      d   t          m            a                                             
          a          c                                                          

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------------krpavl------ge------stdgslpstppp--------
aimspeeeldgyepeplg                      ------pllelv--sgngsp-------c--e-ahvqvnsi
slll rdr nrcgfdsea                      yatksiredgrssdasssgsgdedkvg-ss-lq       
 aw  ggq  a  enape                      lvadnrqsspmpradaknetvegsae tplafh       
  v   p       aei                       hqsrassqnlsahseegdteman  q nl dme       
  p             g                       rkltrflvpsf ecrmak ddst  g pa lqd       
                                        nlrsgpgavq  tvg lv  egq    g  ssp       
                                        ftvnthfktd  qyp hr  imr    a  fts       
                                        esg p vda   dlt  e  nlk        vt       
                                        cpd k at    ikv     cqh        il       
                                         g          ag      a          ev       
                                                    l       t           m       
                                                            p                   
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------e----eeed--elyrqtleiisrylreqa--tgak-------------dtkp--------
sisstkeqttislcdsdset-vssc----ea--e-dsr-l---f--dftglskprpgvkklfpgllggwaeskfsfqslm
               pecgsdeeespagnq vi-n---q-lrs-yq---ti-qs-             rkqta r gldl
               tlasvaapgvqdssv afdse klfvhqsfknysdhp--q             ----  l ag q
               gngdllptvpgsdqt q rtt trv gdlmggvv rgpcd             gnrn       g
               d vyaplvadrkahg l nq  ss  tt  lthi mcrre             sgdr        
               c nvesdcdqnt ad t fe  mk  ln  asac eattc             hshh        
               l dtkyilfgsr yp r  m  qh  fg  cl   avhhs             prlk        
               e t dvtkpyhp r  p  k   c  ca   i     iva              etg        
               a p pmgdirf  i  h  g      iw   v     aq               ygq        
                   mg  hkc  g  g  a      ei         ey               v          
                       c k  e     w      d          dk               h          
                         d        h      a                           d          
                                  d                                  c          

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                   .            
-------------kale-TlrRVgdgvqrnHetafqGmlrkldikned-dvkslsrvavhvfsdgvtnWgrivtlisfga
grsgatsreaeva---sv-mk--vedllek-ry-yn-winrvslddrgd-msfv-a-mkslparrtrr ---as-va---
rgarsagn     rvv- v--g -a-----y-it-k ivcg---e---en---it-i---ilc hpi    v--f-- cg
wepsespg     peik  as  a-nivd  q-vl- -fq- em-eqpgslti-gstpiem g si      t vlt  v
lsh  vme     gysq  iq   gsmiv  kls s  -an n hqkea igafre itta k kn      s  mg   
 ag  h       qsmt   n   nk ms  sm  t  tke a qktq  aqv kt ven  n  a              
  f          hphp        t aa  lf  p  qs  c  sns   rk cq tal  r                 
             et d        r rh  tv     m-  g  giv   h  pk grq  e                 
             d  v        e  t  h       t  q    n   e  ac  q                     
                g           q  g       v       l   d      s                     
                            l          g           a      n                     
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
fvakhlkeinqe-----scieplaesitdvlvrtkRdWlvkqrgw---dgfv----------------------------
v-cqy--tkgrq     nyvalvsqecssy-lsdqks il-nns-   ----                            
-l---qnsr-hg     hsadgfgrcfwt- --e-qe f-r--a    e c                             
a ssrme--qkd     krtss cgivcaa st-egq  inhk-    h                               
m  lq  dmhls     df rr ikh akf tqs  n  aseg     g                               
   es  qt  r     qa tq  vq     men  a  mq q     s                               
   vk  kc        e  nn  st      ay              n                               
       av        g  gt  dk      kh              k                               
        n            a          la                                              
        l                        k                                              
        s                                                                       
        h                                                                       
        a                                                                       
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------effhvedleggirnvllafagvaGvgaglAylir---------------------------------------
       ---r-a-p-stv--t-m----f-tisntivl---cwsallltqstrssasrsrscrsgsr  r  s r   a 
       d  -e- - ---kh- -tvvs- -l--k--fmmsslrkmgrqlrlit lffa i  gr               
       a  qis t asm ta vglltl s-  s t-wsikmdsksgpkqcgn                          
       q  kqp s lil kg   ifcc v   l  qfl gcnvfqeh   e                           
          ylq y ta   s    g a     a  mva asmiv                                  
            d v  k   k    s i     -   s  yrkei                                  
            t a  r                       tni                                    
                 v                       ri                                     
                                         hf                                     
                                                                                
                                                                                
                                                                                
                                                                                

       650       660       670       680       690       700     
....:....|....:....|....:....|....:....|....:....|....:....|....:
                                                                 
-----------------------------------------------------------------
                         cwr           r                         
                                                                 
                                                                 
                                                                 
                                                                 
                                                                 
                                                                 
                                                                 
                                                                 
                                                                 
                                                                 
                                                                 
                                                                 
© 1998-2019