Dataset for protein BCL-2-like of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
                    mfg lkrnaviglnlycgga               glgagsgtgatppggrllatekeas
                        fq                                  ma p sasdt avvag   t
                         r                                        s       s     
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
arreigggeagaviggsag         asppaaltpdarrvarpppigaevpdvtatparllffaptrraapleemeap
    v      t                    st a  s      s     g     s p    l  g l s p    g 
                                                           s                    
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
aadaimspeeeldgyepeplg                      krpavlpllelvgesgnsspst               
 s            c                                          assggsga               
                                                         p ln t                 
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------nrelv-dyisyklsqrgy---a-----------------------------------
  dgslpstpppamamadeesyd--r--v-flg-y-rek--vwg-kspgeenrteapegdlkpaetpsairgrsgwplpd
     msdglrememhtgamedsly-islk-v-rvaq-pavptsqfqdvd dedalwaettsepppylslmtngsahaaa
       lp  rraeaeprtfqythaqaeei-hh-f-iqnascnhmhye      tnlrneeamgntgvsncspagnpgg
             stenmcsgseienslaflnqciepk-ifeldlgtcr       akdsagdqsgmattldgepsavvp
             niipeplmgrvatttqammkfcvlsndhgekmseva        ivesnlrids  rcedanhtgss
             t pssmnapqskgapmyvcclri vdtcarrdddsq        gllvavevaa  as eddeqsle
               s aiaremknsvqiv  yql  ts llvqptafd        saapvgdtsv  fg alqrdnd 
               q  gdtmcy mnkth  rdf   h  dsaelrg         n  rt tae   pi thhpse  
                  srnatr l  gn  m        cd t  l         m  id sdr    k vreqv   
                  tklllh d  st  e         n s            t  dl gnm    q hnvle   
                  ypyna  y  cs  t         g f            q  gr vl     v   rki   
                  d qhk  v      n         p g            f  qp                  
                                a         i v                q                  
                                          a                                     

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
spavngatghsssllgprengg yatksired   ldgtsssspgdgsppstppaasdaetdvsacaagdevvlendtpa
eatpgngspkrpthpdagavnt  va nlq     fndst  rseartlslsterqpqsaleaasapgsn  a dte rq
aeqlsieifspepshtvasgas     a       svar    ddepgsrcpallhaeqrs lvgst        s  kg
ghvrvtdeqqdqknnellparr             rang    avssletprsqtsqatpa   vfq        r  te
dgggdsfasrtaagsphhvtkd             vpsa    vsq ak aa aqe sgqv                 ss
  r tdpklalgdada ttr p             tsq     ef     rg rgl g sp                  t
    p snataretrv pcp l             prr     i      qq hmr                       l
    i  vvn dgpal srs               mct            g  ds                        r
    a  rkp nld q n h               h e                p                         
           trr     d               a                  f                         
                                   d                                            
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------paps-----avkqalrragdeferryr---rafs------------dllsql-hi---tpg-t
lsssflrdftglskprws-sd     klhetmkdvandvqlnhe   tdlq            gmsrkf dl   ksed-
tirq fgny    qsqrapmr     palrvvqesvfgllkkfq   ktyk            ecaanv sv   dnagd
sthr           k -vaa     vts---lat-asmsteva   ynwn            satdgy n-   vrfes
pg               itlp     epaamw-ql eaiieqlt   qr-a            pwintm lg   edvpl
ad               gg-k     -iel   k- q-r-dl-h   asvf            nphqri -r   ncise
el               dehe     t--s   n  sr-vq- s   p- r            qyvls  pt   --rta
                 nri-     rsrv   -  - p -g n   l  t            tiygd  ak   hed n
                 rqtt     s q       l q s  -   -  h            h  c   y    aq-  
                 tknq     q         g   a      i  d               p   r    qkq  
                 k v      g             v      e  -               t   e      s  
                 v q      d             g         l               k   g      t  
                   r                                                         k  
                   g                                                            
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
ayqsfeqVmdelfrdg--vNWGRivalfaFggalc----------ve---------------svnkeme-----p---lv
drkrlsr-vehv-sgpv tr --vatfis-eavva          khlpeqtarwpgldpqplkernqs     s v ci
vvgfvttlankevqrri it   lisive a-fmi          a-cllvkgwnkkwgf  cldigrq     v   pd
-qtiiasisvs-pesht ps   --g-lv - i-l          qrgr   dkkl p    k-leqlg     a   va
lmslana lk-m g -p l     t- -t t t s          rqe         r    -qtqdei     q   qp
pcrm-rn isti k  h -        m-   - -          eyi              ras--ht     n   st
nah- ke --   a  g r               t          -k               gsqmk d     e   el
h--v -k  i   d  n f                                           a k h a     h   g 
 lln g-  a   c                                                q -   r     d     
  i  q   t   h                                                m g         k     
     d       n                                                e p         g     
     v                                                          r         -     
                                                                                
                                                                                
                                                                                

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--e--r-----iaewmteylnrhlrdWiqs-nggW------------dg-----------------------fv------
vdgyk-    pvslsiatvidnrkap lvk qrs-           eea                       -a      
rvdcrn    qlqyfvsdf-etniee fhe sna            g-r                       l-      
gesqel    gfvqecvalvvdtqqt mrd ---             a-                        t      
 gt  q     -gdtswv-aleeths  lq hd              nt                        c      
  a  e      isl  s tgsqhga  ea  k              ve                        l      
  c  s      cac  r  m-d-kn  --                 kc                        i      
  n  a      -t-  m  tgp nq  ir                 ss                               
  p  g      tr   q  -k- s   an                 qh                               
  -          -      i s d   d                                                   
             g        y                                                         
             h                                                                  
                                                                                
                                                                                
                                                                                

       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------elfgv-----------daa--------------------------------
               eleaikarvremeekfyhp          e--enevekqmnmspppgnagpvimsieekmeadar
                             -i-rn          anl-                                
                             a-s-q          kgpl                                
                             dkee-          ssmr                                
                             halkd           etk                                
                             syadr           prq                                
                             pv qs           qdp                                
                             nm cl           agv                                
                             l  st                                              
                                 h                                              
                                 k                                              
                                 e                                              
                                 g                                              
                                                                                

       810       820       830       840       850       860       870       880
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------ae-r---e-fagw--------------------------------lgvgallall--
siyvgnvdygataeeleahfhgc-gs-rvl-a--kv              asvrtfltgmtvagvl  allktgf---ir
                       s-adnsqlrwn-f                   v   aval a   vsitstivyglv
                       glvnkgrmslsr-                   l   v        -t--mkagtavl
                       esiqetsqfsknk                                taaf-vvsemaa
                       ptfsfltvtcgsl                                semsg--cvies
                       lpl ha idvrth                                p-hpvaslavff
                       fag tf alnlmr                                mvqakfgtfstt
                       tvm  e gg m                                  nppvfsmwmtgi
                        i   d  n d                                  ff rni mg m 
                        q        c                                   i  lq  i   
                        k        h                                   q          
                                 v                                              
                                 e                                              
                                                                                

       890       900       910       920       930       940       950       960
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
glkqlyaitlalsrklfrgrqikl lgallaqkrl vipkrtnrpgisttdrgfpraryrarttnynssrsrfysgfnsr
laaeswrtlt sassf         vtsyighrq                                              
sdclkvcli  ide           ivfffvksh                                              
afisfltcs   f            a vivtr l                                              
hkgyytdrr                  l   s                                                
riskamlv                   m                                                    
fgrr gy                                                                         
  da                                                                            
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       970       980    
....:....|....:....|....
                        
------------------------
prgrvyrgraratswyspy     
                        
                        
                        
                        
                        
                        
                        
                        
                        
                        
                        
                        
                        
© 1998-2019