Dataset for protein Bcl-w of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------------------------------------MATPASa--PDTRALVADF
rkkgnngwpmsempllvltpyihaslsslpltlwpnpsypllslspyihasvssltptaar------tsvyss-gv-e--
     m vkprmlsscsfssssyvhvlprtfiga clkrlpgippdapprpppprplitsqswsmdq-  lgnq-- -  
         nplflevryclntsqrgfiqkyv      m   g        llc c amppksmqqpl  ---       
         knkyh qqnqklprpifdcd ps                          lg ge ap e  s         
         dldwg dnhmhd nfgaa   km                           e                    
          e ae alaig  id      cl                                                
                h f   f        c                                                
                g              a                                                
                a                                                               

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
VGYKLRQKGYVCGaGPGEGPAAdPLHqAMRAAGDEFEtRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLV
ly---g-rslaqqta----attns-yr---e------s--hqa-nsisshi-i---t-yr--aetags---d-v----v-
ir  mc ---spep- td -pse- -s   -      eh --- -e--t-- -   - -as ------   - a   yi 
--   -   f---g      -nc   -          a   cn  - v-          -c    c     r -    - 
             -       --              -                                          
                      q                                                         
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                 * .*: .   : *   :  *  ::   .*                                  
AFFVFGAALCAESVNKEMEPLVGQVQeWMVaYLETrLADWIHSSGGW---------------------------------
-l---s----v---d-- ss lpriidyt tlvqsq rrylqhna alsqiteaemadevicseilsdcdsapsspdlee
 - a -    -   -   a     epr g v kdms qg  n t                                    
                  q      k    h   gn     r k                                    
                                   i     p i                                    
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                      . :             .:  *                     
aEftalygdgalEEArrLrE---------------GNwasV------------RtvltGaValGAlvt------------
l-aikarvreme---ek-k-lqnevekqmnmsppp-yagpmimsieekmeadaksiyv n-dyagtaeeleahfhgcgsv
-g---vfs----gg --q-v                -rsnl   l        gplvg wlscslvm-            
sa vt   nrlvls slfq                 th ki             a   dg r keg            
n  lc   vq i d   y                  l                          a-a            
        s                                                         l             
                                                                                
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
nrvtilcdkfsghpkgfayiefsdkesvrtslaldeslfrgrqikvdfkafiyssltqvipkrtnrpgisttdrgfprar
                                             islcfplcilys                     s 
                                                  i                             
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       410       420       430       440 
....:....|....:....|....:....|....:....|.
                                         
---------------------------------vgaffask
yrarttnynssrsrfysgfnsrprgrvyrgraratswyspy
                          i  sg  --------
                                 w rl ler
                                 s      s
                                        m
                                         
                                         
                                         
                                         
© 1998-2019