Dataset for protein Bcl2l10 of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
miyglfvtlfctipnhdhtsagysvavvssfhsphdvpstkimsrggvthsasaegktqlyrrspsavcmcreqsdiagr
                                mfqlswglflleaesadkcldmgvalrmhsgaqrdlwtsvmvdqlreg
                                                         apvwae     snrsaplhwtrv
                                                          mpr a     r   gatppgaq
                                                           cn       e    srsms m
                                                                         mgrfq  
                                                                         h ga   
                                                                         g      
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      :   *  :  :::                  .: :*                                      
-mm-cgLwkeTlrlaeDYlslccrsP-tpappPpseeAAamRrlaadmeqqhqarfsal-q-flgy-ggdrcellrkvme
k-sadpfrer eavlaewigyrateqghqerr-stpsvtvl sagqrlrklyrsflhs-a-tyrrqcppnlvssvalmad
ttkfea qqd av vt fmefsssgtvravstat-ap sli cvtwqiqrrnprvwdnatng-vkhsrthpflnavrlek
gavvpr vl- vq sm   rc tarstqs-la - va  t  hmstvvwaitept qt s sl-vfrqrqhlvgmeqqiq
ad-q s kg  rl  l   hs  qnrnltp-q a m   m  at sksltk wns pl l n itcpeseviyv ww vr
rnyg q hd   g  s   lr   deda gq-   -      g  ry  ea yhl nd   q cd-e l f tq tn  -
mits l e       q   fh   a aw   s   r      y   s  se vd  ev   d  -sa w a qc km   
l gk e         i   y       v   l   l      l   h  py kv   r   a  er  e   g   e   
                   q       s       g      f   g  lv ae   c      a   a   a   d   
                           g              d   e   g                             
                           c                                                    
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
         .*  :. :. :.* *                                             :        : 
elvgdgh-lnWGRVVsLftFaGvLarr----lveqkwkkpgldp--rlkqelgq---vp-rdCrrLaetladyLgg-qkr
avlshspgpt ynlativalt t leqgpsgiltarg----fqsrqgqqeqeadrvleagvs-qgivalissrfverehk
sm-aepqdfs ss  m lv v s mnker  -r-yw-tnws---  ekgrwdqg ligs mns-a--dfvcaqwtkch g
rifdndrpm  lq  a  s   a sqlpe  rqartdvqrdpel  -rrvgvrp   -- gtrye t-w ynf at r  
k- -se-e    h  v      m  kms   qtv--pmglvqkv  q--ld-dn   rr qh sl  tk rgw es d  
-  pkrtv                 dhq   pgstnsltqyytq  vtvkpr-e   lt eq ch  s    l m  t  
d  e nlt                   h   s-knsnpsdems   kpn kqt-   id -   -  q      c  a  
   c  gs                   d   mm klrsr  ha   dee rkpt    g s      n      s     
       r                   a   ve eekrd       aad -ans    e i      g            
       a                       ak cqe             a  r                          
                                c                                               
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 .     **     .                       :                                         
aWLqangGW----dg-----------------------fckfs---rsarev--d-ssmktalfaaagvglagltfllvr
drmleqd  rltvestrrtpgtgagraagkrprgwhgwllhyfekrqtplplsq-nafwrklavqvflscilataliylw
e gedhn     mva  trrrrwrsmvswtgrarrgifivsll   hnlfsarhskgilertmipglsamfvtnsigffl
t  mtlp      t   megdhrgdlhtsni phaa   hlsa   lpsp--nlg ltvtiqfgwf-plyvtnvivhci-
s  h a       s   k   kd   gl la         eny   tdmiqtdse p-qpcs arti-g-wfssvhr sv
v  g         n             g e          qh    sh  ls    tvgg i dll v-issvin f -t
                                        n     kg  kp    qp d h ce  rf cqlm  n pk
                                        d     cq  g     nc c           d      e 
                                        v     nk  a     d                     a 
                                        r     mi                                
                                        c      e                                
                                               a                                

       330       340       350       360   
....:....|....:....|....:....|....:....|...
                                           
-------------------------------------------
trllmsfkifnpllpaqlnqaklkcerpnqskppsetflsafm
dtiirrsqtrsstcltls                         
kkvseignslk d                              
rqtmvfe f i                                
igrcf                                      
vfay                                       
sc t                                       
g  p                                       
   f                                       
                                           
                                           
© 1998-2019