Dataset for protein Bcl-xL of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------------------------------msqsNReLVvffisyKlsQrny
                                            r          mtm-msq-----edylk-----kg-
                                                        een-y-skd  l--v-frftk--h
                                                          ke-r  y  iyh-tk mrcndc
                                                           any     -k  rd  f tef
                                                           yhn     ah  nh    s a
                                                           tgt     qs  q       l
                                                           qcl         m        
                                                             i         g        
                                                             c                  
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
pwsqfs-leenrt----rteg-e-e-etpsai-g-pswhla----vngatghs----d--evip----------------
slnhlrdvndapnstaeapd-t-s-m------n-n---athdspaa--tfngtssls-ar-gp-pspprrlqqqlpsttg
---ligep--pgg   d---aggaglgeagldeeeqrtea-nglv-ss-lvn-rrsrpghp--sspslqqrastatgsas
ctq-meg-dv---   agaaedkdnrsmeqvgsdsats--pa hlsrhs---gnlngavslttraaeqgsqrrrpstggd
nsce-vsstgdss    tdgwadvsarddrrvqakrnpspvv rttdvlvrsreeywehqsskvrrahllplastnaqsn
rirrr-nelqtte    qsnfsqpdvdggaslrnreaitgsp ngr rpssra adtstpkiseqgrca aepasq a r
qcgnnmlnsasld    slvvqreasva nmt  av ldsth  pg  rnpcn   egserrvavtctt e hlqa l c
 vdkcl irniea    en temtrdpn ega     arvr   ip  nat q   vvpnqpa lh is     v     
 ft  i ap gd         nfivyai vtp     vndq    i  ipe m   qt gdml ed ap           
 ni  k qm eq          ag g r  q      rq l    f  gm      pl   ar g  rk           
 ah  p mi  m          t  e    d      gg g                c   ln c   h           
  a     g             h  t            v e                     m                 
                                      l                                         

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                 :                       .   :                                  
--maavkqaLrdaadEFElryrraFsdLtsQLhi---TPgTAYqSFeqVmnElFrDG-VNWGRiValFsFGGaLC-----
  ld---etwkesgnrpqklfaqrwnppsnsmdti  hla thhn kn-vd-v-kgeni---hvigf-a--rv-s     
  iediramplrtse c rgltlsvrhmhptiav    qd vqpt qs lg - q-n t  d----m t r-i -     
  --vaqsv    vl   e hsst kn vl  ll    es   n  at i-   h d -    t  - v   - a     
  ast n-     tr   q  nhg d  dt   h     e       r -y   - - f    n    c           
  vte lv      s      qcq     k         v       d  q   w s           -           
  tkq  l      c      it      v                 a      i             g           
  e p  t             h       r                                                  
    g                        h                                                  
                                                                                
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----VEcVdKeMsvLVsR-----IaeWMttYLddhlePWIqe-qGGW------------drFaelyGn-daAaesrrsq
     mdsiernaqp-lgq     vva--av--nnqiqd-ves n-d-            et-vdifcq nt--daqkgr
     -k-mq-d-rem-a-     -idsv-mq ter-s- mhn - -             vcttpvver plvgqg--f-
     a- av -tgq  ps      ts  vi  e-n da -dg h               qhs-n---k -ghckvsv-e
        -n g th  dh      -t  s-  -h- n   -d                 -- skmsnh g- t-lleay
         -   na  c       mq   q  c t -   t-                 as  -fl g en nli wci
             i-  k        -   s           t                 ga  r c p q   v- se 
             et  -            r           r                  i  g   d     ry l  
             -s  v            n           i                  g  q   -     gn i  
             pl               l                                     s     am h  
              d                                                                 
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
erfnrW-------------------lltgmtva--gg---vllgslf-----------------ark-------------
dslkk-spgmvvedidysgdipgftffv-valv  tvddplvvvvfifilatlvapqfhsfvpisqrrlwltvftwlktl
-t-rng                   m-aaas-l  ma   fia-ail                 vk-hqtcc  h   l 
pnv--y                   -alt-vm-  a-   aaitm-v                 t-qqe a         
h-isfv                   sp-il-gt  -i   ---s-y-                 -tstp           
 acgc                    gipsgiff  sr   ifrplvm                 mlhlk           
 p v                     w id gag  nm     mkt                   rh k            
 q q                       g  n           keg                   p               
 h p                       f  m            aq                   n               
 g i                       s  l             p                   g               
                                            f                   f               
                                            c                                   
                                                                                

       490     
....:....|....:
               
---------------
 fps     y     
               
               
               
               
               
               
               
               
               
               
               
© 1998-2019