Dataset for protein Bcl-2 of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------mahagrtgydnReIVmkYIhyKLsqrGyeWdagd-------------vgaapp-------g
myltfgvstwhwrlspytv-----manec--n--e---ch--lkk-fv-gfdenrasaspdhsasaar--d-pnngsvgd
   pacccplcslekmslspmqpn-r--ysa-vllnxl--p ---k-d e---qqvplph      -qes-etsfydpe-
               hlgmarmwrg-sd-h f  -r mys  asq  a avrvl g  e       sddrtlnvvvvtvs
                  i nansenpfvv d  vl  vn  i t  - -tqad            e-vpssalltpdda
                     slltir lt y  ti  nd    p    msnt             paptedii pl  r
                     l  qgm    v  de  k     n    kphr             gsseag h kg  p
                        ied           f          vees             rptvva f ea  l
                        dva                      rh n             dnrlrr       e
                        a                         c g             qlqdnn       m
                                                                  nvgigv       h
                                                                  le g k        
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
aapapgifssqpg-tp-----------------------pa----------p-arts--------plppp-ap-------
-pnngsvv-pp--h--lfstlvsrnetpsntpktfvgnh--asrdsahtvs-vv-rcveprnspvrpat-a--ggagtap
s--t----a--aesnsaaiaasade dkllqaikeiekagpvppsvvtstttl-s--aaa dlnl-e-stsga       
pst-aelldfssarpa                      taeeharlhscipmashsr        h-q-ahvs       
vtavvatsprhlqaar                      lxggrqg dlag sptnln        crrastxr       
rrsgspatydrxrpsx                      mvxdghp      vfqapt        xqgdlp g       
tqqsrksprnytylvv                      gsrxddx      rxpphx        saxxgx x       
lmlrtqrintthxxxn                      rlqsxxw      qtxxxe        qxlrxv v       
iigpmdgn qigvvqk                      p lptvt      asrlwp        ngtnqr q       
hg le cg lgcpqmg                      x inntq      xi kql         dfenq         
e  i   d ie lnge                      v f ek       ld eni         se dl         
   d   a hd dk                          d  g       h   dg          d            
         aa  d                                         ad                       
                                                        a                       

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                          . ***:
------------aagpalspvppvvHltLRqAGDdfsRrYrrDFaeMSsQLhLTpfTArgRFatVveELFRDGVNWGRIv
pdadaesnpaacr-rlpq-dphaailrv-ce---ele-l-qp--tqi-rlmyf-ssavqrs-ve-id-r-s--irv   i
   asdadahlv-t---pr-a-qglyqagsrlsn-i-dmfhqe s--mg---is-t--hs-vtatm-   h  -      
   gganilvvitrqdg-qs-y------ -d  gq-  -e--t erlhqvnv-ntvyp-vk l- ak   -         
   ennvstnrkplpetxpemqsd nts m-   k   i vs  d   he t grav s-a -d -    q         
   yxtgairggkxxasvha lmr  k   s         ll  r   -  g a ns kx  r                 
   xvqtveqpdxpsxvrg  dle  c                 -   e      -h et  i                 
   prprtnci ggetxme    l                    v   d      d   e                    
      pgdph svavqsd    h                    l              a                    
       e gd qsvsl                                                               
            nq ik                                                               
             n  d                                                               
             d                                                                  
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
         .:: * .  .     .    .    :  :                                          
---------AFFEFGGvmCVEsvnrE-MsplVDnIAlW------------------------------------------
fvssqagqlgllg tatvsskcaskqeltsqqnsvveynvyvtvayppdtdtpgfaeenktkpletrlisettsvckpeq
                yi  gimanggaaa  mh kd                                           
                ms   ffi  d f   eq  v                                           
                 l        l e    k  t                                           
                                 e  h                                           
                                    g                                           
                                    p                                           
                                    n                                           
                                    a                                           
                                                                                
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     :.: ::  :   * .:                                                           
-----MTEYLNrhLhtWIQdNG--------------------GWdafvelygp-----------smrplfdf------s-
vakqivkdaiqgpfnss keq-ymlssltcgmapvtsitegl---------drqemfsggwtihqr-sv-sccvsrag-y
           sy qn  esd                     qqvgasaie--           --d--s--      yl
           qt ea  g                         etvrpvtsq           nvewmvhs      r 
            n si                            alpqvmlnn           tgqhiqnl      p 
              r                             rhmcspges           kkg amcq      n 
              g                             q cadh cv           haw phrp      f 
                                            p       t           gls head      e 
                                                    a           ail g           
                                                                  i             
                                                                                
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
wlslktllslalvg-----ac----itlgay-lghk--------------------------------------------
-p-i--vfg--al-dkdvi-asepgl-i---s-tq-spstvsrsqsrqpwmsskprsiqvpvpplspcqnrhkskqqrep
v-y-ta---wv--s     l-gage-v-vtl f--vptlssqqqpcdpiclllhlleencfplfape             
rirvxkiwavlvi      vvd   vsessf ratsmrfqpi                                      
lskgwsnmtpggt      qr    tqyrrm qsrqg eaeg                                      
fvgefcmgn c r      gt    rpwfmi mpld                                            
 rf e g     q      d     kkvclc gkk                                             
 f    f                  ggsai    g                                             
                         c k g    c                                             
                           d f                                                  
                                                                                
                                                                                
                                                                                
                                                                                

       490     
....:....|....:
               
---------------
earpreqrmsevesh
               
               
               
               
               
               
               
               
               
               
               
               
© 1998-2019