Dataset for protein BCL-2-like of organism Xenopus tropicalis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                   :  .   ** .                  
-------------------------------------maqsergs---ralvekfvryKLsqrsl---------------
rmrqsvivkqrtwegqlitgqiyfsgspgkylteqgwkevpsl--ypwddimvdy-hk  crkgynwfggrsqvslthsq
mkkgnnga d dsaefhapcnficr ggdgnas      hnr- gsdh  d  ahicd  d pqaegeefnqgg aeap 
                                       g d  a                                   

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                  .:                         *     :                    :  .. ::
-----------------vpesp-----------------------Gaassslhsa--------------l--lrragdef
esglissysqpsqvsssssdpavcpkdglymdtqqlilaffrgyc ptqcivkesaassllmqpvppkv-qtmsavsgdi
ageefenndggkgmpngpa gr                        eptgg gae   faahhgah aa ea qd  e  
 caad di ddgeg aa                              e    a                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   ..  *  :   : :        :  *   :*..*. ******:.: **  :.    . ::   :  :  .:. :*  
eeryrqaFseistqlhvtpgtayqrfaeVvgslFqdGv-NWGRIVaffvFGaalcvesvnkemspllprivdwmvtyLet
srlfqrd tqmtqrislhssevraslst aeev rg tt      tvis  rvvaahlksrdltecvmslqqhftqf ns
ilkhh rgllgl  i qr dqvk qq pal              e  gfm k  a i  ed ida ag   l  mh
         d  a      d  l                                              e   e    

       250       260       270       280       290       300 
....:....|....:....|....:....|....:....|....:....|....:....|.
  . *: .: **                                                 
nlrdWiqsngGWngfvtlygdgaiee-r---e----slktvltgavavgalmtvgalfas-
tkqp mleqk  e--l----------a-rqr-gnwa------ma---l-----------rk
kn  iqe   -a -gffhkedyass egp     rfrrw --ist-tvatllvsymr-r
              d   i  a q          g g     f s a  gagl fli  
© 1998-2019