Dataset for protein BCL-2-like of organism Xenopus laevis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                             . . :  .                                           
--------------------------mggssrdlvekfvskklsqneac-------------------------------
mmhqsviakqrpstsflipcqfypsrgeydhktisvr--------kgypweegrqqvsthrpqlsglisnysnggsmpcs
                    mahcrg  s e    a yihy    gasa d   pdmdaeh  anaa  gfndd el aa
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                       ..:             ...   .. 
-------------------------------------------------------rklsnnp-pyryysgtstserpgeg
sedsrgppqsslssgstsppetpsntpitfvgnapavprrsasavspldglyvetqqfnva-qfspvsnepnsgalgase
qa eldedmdngaqaas deds                       c kae nmdp d il  nanailm eend de dc
                                                              d m aad d         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     *   .*::*  .  *:   ::  *  :   * :        :  *   :*.**. ******:.:.**  :.    
atqgiVeeevLqtLlrateEfelryqraFsdltsqLhitqdtaqqsfqqVmgelFrDGv-NWGRIVaffsFGralcvesa
lvmqp pska ea sevgg isrlhhqd tqmsqr slhssevrvrlst velv n  tt      tvie  gvvakhlv
 l hg hha         d  iek   rgilgl    pr dl k ae pa   h                afm   ik
                                                                                

       250       260       270       280       290       300       310         
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....
. ::   :  :. .:.::*    : *: ::   :.** ::         :    :  :* :..    .    :.   . 
nkemtdllprivqwmvnyLehtlqpWmqenggweaFVglygknaaaqsresqerfktlLtivvltgvfal--vcymrr-
srnlspcvgvlaghftqf nrskkn iiqq---dg  effn------ieqywsslgrv -mamvsvcvtigglslatkr
 l  e  ids  e    mmh  d    ek      d  hs iqppfdd elgi  i sl isgaailga ia  i  
                                                              f                
© 1998-2019