Dataset for protein Bcl-xL of organism Xenopus laevis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
******************************:* .    .*****************************************
MEGSSRDLVEKFVSKKLSQNEACRKFSNNPqPnpysngtSTSERPGEGATQGIVEEEVLQALLEATEEFELRYQRAFSDL
                              n mailmep                                         

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
TSQLHITQDTAQQSFQQVMGELFRDGTNWGRIVAFFSFGRALCVESANKEMTDLLPRIVQWMVNYLEHTLQPWMQENGGW
                                                                                

       170       180       190       200    
....:....|....:....|....:....|....:....|....
*****************************:**************
EAFVGLYGKNAAAQSRESQERFGRLLTIVmLTGVFALVCYMRRR
                             i              
© 1998-2019