Dataset for protein BCL-2-like of organism Ursus maritimus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
         . *                                         :. .:: : *                 
-mhtpasapdtR----------------------------------------alvadfvgykLrqkgy------------
m-a-eippasn pmshrpspagarliwpxxxxxxxxxxggwkmtdcefgytltiaqkylkhv s----swsqfsdveenr
 a-a--tsy a                                         e  v  is   q r              
    grmgq                                              m   h                    
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                     .             :. .   . .:.. . .  : .:     :
-----------------------------vcgagpgespaad--------vlhqamraagdefetrfrrtfsdlaaqlhv
teapegtesemetpsaingnpswhladspipqp-sapgrvsqarevipmapvrdvlssvqgdvsknykpcldsfdv---l
                             ----a---dsspp        a klta q      r l  d aemts   i
                             avng t h   l                e      l    a    s     
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:  :*   *  * :: * .*  ****:*::* * . :  : ::  :.  *  ..:  ::. ::  .:  **...***   
tpgsArqrFtqVseelFqdG-pNWGRiVafFvFggalcaesvnkemsplV--sriqewmveyletrladWIhsnGGWe-e
svdt qti nt vdke rg iv    l ti a eaimtvkllqerievd dagqvsyfvaafitrnmre  rqs   vl-
  f  ygs  m  e   i         s   v  k   d q     dn at  tt  ndh ht  qe    sgt
                             e                        l          ep   d    d l
                                                                             a a
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
fpkayvrgmeeearklre---------------------------------r----g-----------------------
aislrgkealvsserrkilqnevekqmnmspppgnagpvimsieekmeada-siyv-nvdygataeeleahfhgcgsvnr
--lgsasnlkrrnpwgtf                 was              twst glllqgqvt pgk          
rveef nkfhpk lg s                                   gvl  a ag  ltd              
ptd c d caa  g  q                                                               
  a                                                                             

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
vtilcdkfsghpkgfayiefsdkesvrtslaldeslfrgrqikvipkrtnrpgisttdrgfpraryrarttnynssrsrf
                                                                                
                                                                                
                                                                                
                                                                                

       410       420      
....:....|....:....|....:.
                          
------r--g----g---lts-f---
ysgfns-pr-rvyr-rsrag-w-ssk
 rfnrwfvtattvamval--qyylry
     relm mise svvvkal ap 
     l aa kfc  f  re f    
                          
© 1998-2019