Dataset for protein Bcl-w of organism Ursus maritimus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
****************************************************************  *          ***
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWelEaikarvremeEEA
                                                                a- ftalygdgal   
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 .*.*               ** ..*            *:: .* *  ** .                            
ekLkElqnevekqmnmspppGNagpVimsieekmeadaRsiyvGnVdyGAtaeeleahfhgcgsvnrvtilcdkfsghpk
rr r ---------------  was ------------ tvlt a al  lvt---------------------------
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
gfayiefsdkesvrtslaldeslfrgrqikvipkrtnrpgisttdrgfpraryrarttnynssrsrfysgfnsrprgrvy
--------------------------------------------------------------------------------
                                                                                

       330   
....:....|...
     . :::   
rgraratswfs--
-----vgafylsy
          apk
© 1998-2019