Dataset for protein Bfl1 of organism Ursus maritimus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MHTEIPPASARPMSHRPSPAGARLIWPXXXXXXXXXXGGWKMTDCEFGYTLTLAQDYVKHVLQIPQPGSAPSRASQVLRD
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
VASSVQGEVEKNLKPCLDSFDVVSVDSARTIFNQVMEKEFEDGIINWGRIVTIFAFEGILTKKLLQERISPDVDASRISY
                                                                                

       170       180       190       200       210         
....:....|....:....|....:....|....:....|....:....|....:....
********************.    .. **  : .:   :   . ..:.   *: :   
FVAEFITTNMREWIRQNGGWs----sgsVKkfkrrspwrtfrrvmgtisemsSvrk---
                    ellppdaf  gcepkagglseleaaakfcagf lleqyy
© 1998-2019