Dataset for protein BCL-2-like of organism Ursus americanus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------------------------------------------------etrarrprgpp
mfglkrnaviglnlycggaglgagsggaassggrllasmsqstrrrvvgglsyklvqkgyswsspsmmpa-dtptvatlt
                                      gkeanaele dfgeagasig sagaqfpdvl-p-mefgysts
                                                                  atemn eaaaerae
                                                                   ad l c    l  
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                             :                                  
prrayvppvlgtpprppg-----p-aap--asapagpvlssvapvvh---------------------------------
dyqessadsvqsks--l-prrlp-p---aa-atalrdairpap-elqgyepeplgkrpavlpllelvgeasggpctdgsl
stmdtpsritay qwq-fysptvrgstgsssvqveaegepmpqg- k                                 
lil lgkhfp n l lkale arna p hrmelg  a am  eeq e                                 
 eg ec aen i a h  d         ee  gd     g   dp d                                 
 a             a                c          a                                    
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                         .            :         
--------------------------------------------------qtlrqagddf-rryrrdfvemssqlhltpg
pstpppaeeeedelyrqsleiisrylreqatgakdakplggsgaasrkallamkrvlseys-----avsdlva---i--f
                                                  krhepf  svetnhgttrasvtrkve-kn-
                                                  en  hc  g qlgfegn qg l   dveil
                                                      e                d    r  e
                                                      a                a        
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
             .     .***:*::: * . :     .   .                           :   :    
tarqrfaqvveelfrdg-vnWGRiVaffsFggvlcvesvnremsplvdnial------------------wmteylnrhl
---gs--t-m---hsqpvts   v tlle eaamtkrlpsktyevdisrvresygereagvrqdcrhlvdfvatvitttm
sdy--lt- -vkv qg ip    l  iiv a tvlek lqirqqscgpqsqtel                slvnr vgrk
d vti sr snhe p   l         t   i aah kdgni n  gpqei                   icdf edqh
a qk  n   d   e   i         a   f       e      edl                       a    n 
      e                                         a                               
                                                                                

       330       340       350       360       370         
....:....|....:....|....:....|....:....|....:....|....:....
  *:    **                                                 
rtWiqdngGWdtfvely----------lregle-s-r-vltgsl-vggvv--ga-l---
hd lvssr  angf--fgdgafepmsr---f-wv-vkwf--aa-glaalitl--y-srk
ep  rqqd  vh--vk-    ntsarpwvt-s-rwp-t-es--va-----yvwsrfisf
ae  hkh   eg tcfk    lpekqgvlldqdltn nlcplmt avqyylglkl gh 
 a  ee     e  a      gna lesfk n ggl lc mffq  kicgaf  f ce 
     a     d             aah d k cfi i  l  a            a  
           a                     a g a                     
© 1998-2019