Dataset for protein BCL-2-like of organism Tursiops truncatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mfglkrnaviglnlycggaglgpdsgsgasapgrrllaagkeatagrevgggeageviggsagpsppatlapdarrvarp
                                                                               m
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      . .        : :   ...               .*                                     
---gatgpdnrelvadflsyklsqrgy-w----dvgvnrtesPeat------------ps-----s--g--p-----d-p
spt--ssysvtatrvryvhfaptrkass-sqmsvsvsgpitg ggeldgcepeplgkre-vmpts-qv-st-swsrt-s-
mhiprmaq t  i mklig   r    ppeefescdedggma aed             aplilpelpngnsnsplksps
aaa  e            f        e      a aaaa     a              dgefl ai ea aphga g 

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                      :                             ::* .** .. ..   *  :  :* :. 
-p-tap-a----dal---p---vh---------------------------qtlRraGDeferryrraFsdmtsqLhitp
p-s---p-sssl---yvv-mpvlsrylreqatgtkdakplggsgaasrkallam qv  gvstnhett qglsrk dvkn
lvqvptghpeggpersrqsleiik                           e   e   d ql f  d ae la   l  
a n   a eaee   epi  aa                                 a                      

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      :  *   :* .*  ****:*::: **. :.    . : .  :  :   :.  *      *: .. **  *. ::
gtayqsftqVvvelFrdGv-NWGRiVaffsFGgalcvesvnkemeplvsriaewmttyLnrhlrdWiqsngGWdtFvely
fsdvkrlst snhv sg pt    l tliv  avvakhlksrnqsvcigqvqlsivev vttkht lvksr  ag tdff
ed rg  er me   q             e   fm a   di  q epl a  a edr ep  heq    e  a  
   q     d                                    dn           a        a     

       330       340       350       360     
....:....|....:....|....:....|....:....|....:
                      . .*     :..     : :   
gvsalee----r-lf-------rwvLtgav-vggvvtlgaylsrk
hpnm---srkg-r--ngswlsvktl slmtglaalllvlslfis-
 ngdaagg   qprrefn a l nf lafla   ciag  f gh 
 de    a    e  d     i a     a     g      a  
© 1998-2019