Dataset for protein BCL-2-like of organism Tetraodon nigroviridis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
         .. ::* :::   *:*      :: . .   : .* .  :*:.* :                    .:.: 
--------msvstqRtslntmnVmFynkyklsqrsysqspmvsPssrtnGqvGttq-------------------sngtf
rshpgakskgaian maidrel i qigvgdadlnsplihige rdafe nf dspkrpskltvvkpkvclsktiqedse

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:*: * ** : *    .::.  * .**  *:..                                 ::  .:  :: .: 
nGssPgTPpspSqhvqsvtsrpAvkEAlrDtgt---------------------------------elmlrytytysgmi
d al c  eah gdqldlsgld gd  al sdnrqlvsrlmadvtgisraqwresralattkrvvgdfeekhrcafrdlh

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*:*.:   ..  **   * ...* ** .****:..*:**...:.    ::  .  * .: : ::.** .  . *: .:..
NqLhmtprvgyvSF-gnVmksvFrDG-vNWGRvvsLlAFggvvcvylvekgqrplVgrviqwmtvYLlthqrpWlqsqng
 k fiedatadq  vea adet e  nt    iag f  aaalaqecndhemndc eqiaeeist  dndiqd iiknga

       250       260       270       280      
....:....|....:....|....:....|....:....|....:.
*: *.*:*    . .: *:       :::.:: .***.    :::*
WerFvElFqvpdpestvRt-------vlmgvslvAGIglksflvmR
 dg a f gqdaaaesr sqerfrnglflamaga   aaglaili 
© 1998-2019