Dataset for protein Mcl-1 of organism Sus scrofa

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
****************************                                                    
MFGLQRNAVIGLNLYCGGAGLGPGSGSSasapggrllatgkeatarqevgggeagmviggsagasppstpapdarrvarp
                            ----------------------------------------------------

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
spigaegpdvtatparllffaptrlasppeemespasdaimspeeeldgyepeplgkrpavlpllglveeassgpgtdgs
--------------------------------------------------------------------------------

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                   *************
lpstpppaeeeedelyrqsleiisrylreqatgakdakpmggsgaasrkaletlrrvgdgvqrnhetAFQGMLRKLDIKN
-------------------------------------------------------------------             

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**************:*****************************************************************
EDDVKSLSRVMVHVfSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFF
              l                                                                 

       330       340       350 
....:....|....:....|....:....|.
********* * :                  
HVEDLEGGIrNvllafagvagvgaglaylir
         s kiaf----------------
© 1998-2019