Dataset for protein BCL-2-like of organism Sus scrofa

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------mtrllvndyigyklyqkg--ag-g---------pGsgssasaphq--------------
mlllaaaflvafvmmtpasapdfgaqraavlklnvrcgqyv--l-tdveinrykapeapakdsrggrdissqpswtpapa
            mlaaddesgyihmkaqkfvsavmsipegscsafkciaeecteq afttstplvpsafngn grhl   
             allyrvfysnseipv lph haq--  ew q      dagd  t irq----lgi            
              h gmtrqr ar lt   e c vvt   s i              aplv stea             
                  mgel  p  m         r                     egp ep-              
                  f        l                                 e  n               
                                                             a  a               

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------alraagdefetrqrrtfselgmvlhvtpgsa---------rfvqvs
rtsppptptvpgatghsssldgrvvspvppvvqlvmlsvqk-atanfevglgdaaaqiggsarasppstpapqq-rtarp
     ds aana  aaaaaaaapeli maa kh raf-tanqv-k-ykpcgdnfdv-sid-v-ti       daf-qvqv
                                  ---q---k-seyl--------sf---r-si-       ygsn--me
                                  tk lq adir-k-vindkvyv-crwnd f-v       r awyt--
                                  d  e    eir ns d aqvtl  sl  eqd           ms l
                                     c      l h  a   msg   i   l            e  k
                                                      r                     a   

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                    .                                                           
selfqggpnwgrivaffvFgaalclesvnkeme--------------------------------------------plv
dpigaeivdvtatptrllnfgptrkalpre---spasdaimspeeeldgyepepvittmkerrvgrivflgkrpavldtl
k-ferd-i----l--i-a e mmmakhlprdlsritpevl  vnylgsv psra               vssqagq --y
en--d-a-ekyg-as- - q i svsgkknacqvskk r                                      vv-
-lvs-r q  l v dm t c v lerdif   g k f g                                      n s
n aipq      p  l s a g   l  d                                                g f
l   k            e                                                              
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
gqveewm--yl---l-----wiqssggwt---------------------------------------f-plygnga---
kliay--at--etr-aqhrt--hqn-pgedgslpstpppaeeeedelyrqsleiisrylreqatgake-k----ssfasr
-e-slfvvefitrntgd   ala--v--dnvyvtvryremtdtpek          kfaqnnvekqmdavlmgqd--vkk
s-tq-sstllcnkhsht     rme kpaleaikaav  d   a            ge e ek  pltttepse-tsqqt
rrc-tl sk aiql ep     -e    -                                      nmsaip tnmpce
dn r       adg  e     ld    y                                      g r ff pal a 
 f p                   a                                           a c    g g   
 d                                                                              

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                   .            
-------------------------------------------------------------grivtlitfgafvakhl-s
kaletlrrvgdgvqrnhrtafqgmlrkldikneleahfddvkslsrvmvhvfsdgvtnwygvplsawvsvswvt----k-
feqveaqslreknwasvesvltsavyygstlt      hgmgpvtsitegllq kfvgl  pkkrpyfd-vel-lskclm
w   vkmiik amegdfn syv ngdm asae      c ca  n     iqc a seh  eagggrln r--sgvi el
s   ai   e  i   a  iig d                                     ---qv  f  ycf  a tg
p                                                            tsmme  e       v   
                                                             r hf               
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
lnlescie-l----------------------------------------------------------------------
i-q-g---p-aesitdvlvrtkrdwlvkqrgwrpgisttddgfveffhvedleggirnvllafagvagvgaglaylirar
-c-v-vyyt gaylghk f grqikvipk tn        r  praryrarttnynssrsrfys fnsrpr rv rg   
maklkqcls  slfsrs                                         kia                   
 y wravi      de                                                                
 t a krt                                                                        
 d    l                                                                         
                                                                                

        
....:...
        
--------
atswyspy
        
        
        
        
        
        
© 1998-2019