Dataset for protein Bcl-2 of organism Sus scrofa

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      :.:    ::: *:   *               ** . . ** .   .* :.. ..  .    .  *  : .*  
-mlllrtgylvrfvvmlYmvypL--------------iSPkplplPGihvvvtGrtsgpgrtsppptytqpAfttlvArn
mahagaaafdnaeillk ihsk sqrgyewdagdagaa  gaaaa  afssqp gspaiakciaiecpkag aiaaa aa

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 . :*..   : : ::.:                  ::. .. . .:. :.  :: : ::  *.*  :  . *    .**
egpvLspvppvvkltlrqkq----------------envsrryrrklgpvssqvnltpmtlsGrFetvvvstFrr--sVN
adkl qakkeiehhsindagvvlcisvdvsqdysqvddfikqaqedfaemdmllhcagfsar k adleeel edlmg  

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:                   **** . . .* : :                 *::: *:.*    :::            
y-------------------GRIVfvssqgGvmgv-----------------EsvqrEvsPyvvyvtv------------
wlgsvypsravittmkerrv    affefa qlclfgftayssskfairgla alnm mk lndnialayppdtdtpgfa

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                             :.: :: :::: * .:*                     .************
----------------------------wvteylqrnlntwIqsnG--------------------qwDAFVELYGPSMR
eenktkpletrlisettsvckpeqvakqimkdainghfhss gdd ymlssltcgmapvtsiteglgq            

       330       340       350  
....:....|....:....|....:....|..
********************************
PLFDFSWLSLKALLSLALVGACITLGAYLGHK
                                
© 1998-2019