Dataset for protein BCL-2-like of organism Stegastes partitus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       :   :                    .  .         :                                  
----msqnrelv--vyyi----------kyklsqrnyplphmvpneapnrtdgsearpaeeqrtevhangt--g------
msimsytkttvlmseflspqngvvegqmshgtgppsaqwn---lsdsa--n--g---l-----l-t----gfn-tslrqv
 nmipwse ni aedkil          lccs khg atsmlsvr ehgg-v -vvt-prtnv-r-stts- a pg    
 ecgntk  la   c f           h       pgldr l  daa n dktnskpslnrlcnsrn    kd    
   alec                     c         i fad e      e  g d  apkg g  ea           

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                               .:     ::   .   *  :                             
---------p-tpp---rrl-----mdavkealrdtanefelryqraFsdlss---------------------------
sdsledssl-g---psp---astat-----avmknstdqlislfaqd tsmhrprwnegkalstmkrvvedvlekhryay
         nesdelqsdsetqvssip ihr  eelgrdm rshtpr hg tq                           
          c   hlc   pdsdphe gd    cd q   kq lk   e  k                           
                         ca        a         a                                  

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      :           .  * ..:. *   ****: .:. * ..:.     .                         .
-----qlhitpatay-ssfenVmdevfrDg-vNWGRivglfaFggvlcvecvek--------------------emsplv
ngmintfylqstpdqvqrvss ikslvk rtt    vtsfvt taavarylqdrrdtkpglepgkrqelgqgpvnrtsqa
     k srddrg lcrflrr a  g  hl     ia  e   t  qq kaqe                   gcrnc 
       l   g  d h  ke      a             c         a                        ng  
       d   d       aa                                                       ee  

       250       260       270       280       290       300       310  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
  : :    **      *: .:..*: *.::              .:.    :      .   .        
griaewmtvYLdnhiqdWiqsqggWdrFveifgqdaaaesrrsqpslkkwllvgatvvtgvvvgsliaqkr-
dtvvd----  nepqss lvknns eg akf--------asvvweeftvvttlmmaagvs-laavylllv-l
pn s eist  lgelrl  le   c   lydrqrssv- easqdistrng fglllfalti ttftkiqs
el      m  gcdkn    d     a         dlsf c rd   rkfa a fgaa gig l a     
        e      k                           d    m               a       
© 1998-2019