Dataset for protein BCL-2-like of organism Seriola lalandi dorsalis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
             .  :                                                               
-----askqnrelvefyisyklsqrnypw------dsp-rt-gs-a------------s-a-ngl-v-ssp-cctrqsrs
mnsiq-wyytanvavnflkl---------tlssvr---n--n--t-glvppqvvvtrs-k-s---s-t---rypqspqsl
 mlcmmpssa lt  k cihrqnkslevtshmrpnseggini gkvccdngptlprhnrgtptstlpnttnnsgrpltqe
    glmee  ai  d  fc   gggctlrfleleeadeaae dil  aeenriandcnernk peng rdgla kg pa
                  c          gdddgd   a  d  e            a a f   d d   e    a   

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 .                                                         .   :.   : .   .   : 
pphvs---------------------------------------------------ihav--alrdsadefellyqyafs
dsttgdgslpctpemqsdgetdvpscpagevlesdtsqlisqsmksftgrsiqrrtesraks-mkrvvqgvltrhsrryt
  ppe                                                   le  lqt  gmgndm rqfrqd n
  dgd                                                    d   e   ea e l ek np  h
   a                                                                        a   

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 :   :           .  * ..:. **  ****: .:. *  .:.            :             : : :: 
dlsnqlyltpt-tayrsfasVmdelfrDG-vNWGRivslfaFggvlcvecvek-emsplvd-----------rivewmtv
tmittfviqsrldpvsrvrn iksvvk  tt    vigivv tvtvarlmlqtnrvtsqlspgqgqglrncrsvaqtism
g hrk stdngg dqqflkk a  g  hl     aaf t   a  qhlkdqenrnng g           nlgde ak
e aq  h  cd   ch  ge      a   f         e         ia  g eec e           g      e
      d   a        a                              a                            d

       250       260       270       280       290       300   
....:....|....:....|....:....|....:....|....:....|....:....|...
**      *: .:..*: * .:           .       :  .     .  .   :     
YLderispWiqsnggWdgFveff-qdaarvasrswesvktwllaagvglagvtvg-livqk--
  nspqrd lvkqns er asm-g----aevrqessvrtrlfavgvtmvtslvm-vyltr-rl
  lnhlqs  le     c cklydsqsesdsdpdrpmkrkvmgl mllgi allas  skmm 
  ggekn   kd     a   i  rhr   f c qkaina   f afaa    i l  aa h 
    d k                           l  f        a      f a       
© 1998-2019