Dataset for protein BCL-2-like of organism Seriola dumerili

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
         .   .  :                                                               
-----sskptrftvenyiihklsqgnytwtdgsgdsspertigstic-----------skrpnglevtstngyctrasrs
mnliq-pyynaelamffcycrqng-lep-------d---ia----a-shngnvvpndn--a-ks-----s--caqkqqse
 mscmmwss  nv vk lsy----s---tslmrvr-egn--n gk-nlvppqtlvtrcrg-s--tspnt-prsprsptql
    glmeq  ai  d  kl   krgcvlghlepneadgane divg  eepriarhanetnt plng rdnlg pl pa
     a  e         c     q     fddle   a  d  e a            a f   d d  ae    g   

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                     .      .   :.   : .   .   :
p----------------------------------------------------prwtehrv--amrrvadevellhryaf
dsdvddgslpctpeiqsdgetdvpscpagdevleddtrqlisqsmksftgrsishtsisaalqtlkdsvqgflekyqrry
                                                      tpgle  ks-  smgndm trfsqd 
                                                      pge d   e   ea   l rq np  
                                                       a                     a  

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  :   :           .  * ..:. **  ****: .:. * ..:.            :             : : ::
sgmsnqlsltpt-tayrsfgaVmdelfrDG-vNWGRivslfaFggvvcveckek-gmsplve-----------sivewmt
ndlitkfyidnggddvsfvas aksvva  tt    vigivv tatlaqrmvqtnerencldpgqgqglgncrrvgqeis
tt hrt vtqsdl pqqrlrn i  k  hl     aaf t   a  rlllaqervtsq s           nltdt a
he aq  h  ca   ch  kk      g   f         e         i   n neg g           g a    
       d            e                              a                            

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 **      *: .:..*: *  :                       .     .: .   :                    
kYLlsdqrdWlvsnggWdgFveffr-qdpesevrrslmafkkwlgigatl-aglligallvrk-----------------
v  derisp iqkqns er aam-gvaqaaakssntwesvagfflaavvgl-avtv--yi-q-rpkqegkiaffpmscsr
m  nnplqs  le     c ckly- shs rvf qdrsmkttvaav mlmvts vmsvmmt-shl               
e  gghkn   kd     a   i d r r   a c qp imal  l ga a    frs fek                  
d    e k                                                 c  a                   

         
....:....
         
---------
eahfhrahs
         
         
         
© 1998-2019