Dataset for protein BCL-2-like of organism Sarcophilus harrisii

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                  :                                             
----------------matpa-saydnrelvmdylsyklsqkgye-----------------------------------
pvtsppwpslpsplgr--h-grrgpythaiiakfvhp--r-r--awslpnlrtprspslppvvesgptvsnfsnsprstp
hsscsirffflfigsqcs-a-evshsvamaa---ighed-l-  -peaggk paalam  laragadasgiargqlpnrt
dfga  fc  fa a i  p dcmfdga d  v   k   e d  n d                         qfedeh  
                  m   e        q            d                                   
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                  :. ..  ..      :. :   * :.    
-------------------------------vatgpgvgptppv--vhrtlrqagdeferryrrdfsdmssqLhitpv-t
ppaeptelpttvtlypswsplptryvvgattcgastaessvnepgklsqamqavafdvssnfettmdellgt dvksgds
lasagqdiesstngsgrsleaispplse agqsvmlrltkplrsaatlli  r   s qlev ka qtfaak  l ne e
e   ed daeedeaaaqnh  dp aara   hqs  kdhecihr  ake   k   g  e h    eg tr        c
                                 q  da              e                           
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    .  *    * .*  ****:*::: **. :            :          .         :: .. *       
arqrftqVveelFrdG-vNWGRiVaffvFGgalcvesvnkemeplvds---ialwmteylnrhlanwiqsngGw--f--l
dqgsvat sdkv qg va    l tlis  avmikkllsrrqsvtmgqheevtsyivtvkvtskhdylrdsk aat-ve-
 yri ss mthe s  it       i e   ivaah krinapsciat   lsrsgahliqnqirr  pqqa  gektaf
 ika nr  n   e   i         a   f      dh   l   r   eqhf  df mkn dp  mkk   eg aic
                                             p    ke      egi  e  h   d     
                                                     d      de                  

       250       260       270       280   
....:....|....:....|....:....|....:....|...
                                           
ygvsaleearr------------l--a-a--a-v--g-ff--k
--dg-------lregnwasvrtv-tg-v-lg-l-tv-a--as-
vh--gpfqvsknqn    rfprwvltnftvvsvklwnvlysrr
m tedaagsifik     fennm wpgm gigt il sasll 
f nd    ng g             l   da g ga l  fi 
        g                                  
© 1998-2019