Dataset for protein Bcl-w of organism Sarcophilus harrisii

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                ****************************************************************
----------------MATPASAPDTRALVADFVGYKLRQKGYACGTGPGEGPTNEPLHRAMRAAGDEFESRFRRTFSDL
hssspiffslpfiasq                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************* : : *   :  ** :: *..* 
AAQLHVTPGSAQQRFTQVSDELFQGGANWGRLVAFFVFGAALCAESVNKEMEPLVGQvqrymVtylqtqLArylpSsgGw
                                                         ekdwg hlkegi  dwih ka a

       170       180       190       200         
....:....|....:....|....:....|....:....|....:....
*************************************************
AEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
                                                 
© 1998-2019