Dataset for protein Bcl-2 of organism Sarcophilus harrisii

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                ****************************:                                   
----------------MAHPGRRGYDNREIVMKYIHYKLSQRGYe-----------------------------------
pfgcspwcsllsplgi                            dwdagnlrtpaspslppvvasapavgifsnqprhtp

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                               *************************************************
-------------------------------VAAGPAVSPVPPVVHLTLRQAGDDFSRRYRRDFDEMSGQLHLTPVTARG
lpaapqdlatsttaaarnsplppppavaaat                                                 

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*******************************************************************      :*.*.  
RFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDSIALWMTEYLNRHLHNWIQDNGGW------vGvSg--
                                                                   gtkaicm t apf

   
...
   
---
qvs
© 1998-2019