Dataset for protein BCL-2-like of organism Salmo salar

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                        :: . * *  :  :  :.    .  :: *  . . *    .  .  *         
------------------------mtysnReLvvfyityrlsqrnypksqvgLtnatgrTevrqvtlgvsV---------
mslsnsitratttmlhfqnggssylsdna p yyyqgsgkicagdssfnkme gggsnd ppgptigngn vtyngvnnt
                       m a d       a a    a  cchld ee q    gddaea aa lks  ldgh

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  . .    : *.:*.  .   .                                          ::.  .::.  .:  
--gtsrsrqspPssPq--sgmgpvks---------------------------------------alrdsvnefelrytr
ssdrpppnlal ct rrtgeleaelencpsgdevlehdtrqlienflgdytglsqprwtqskplttmkrvaedviakhry
lp n nndd k     maa cd   a                                                  

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*:..: ::* :   .     ::.* . :* **: ****:..*.:**..:.    :.  .  *  : : :: ** .  . *
AfsdlssqLhitp-stayqsfesVmdevFrDGv-NWGRvvgLfaFGgalcvecvekgmsplVgritdwmtvYLdnhiqpW
 yngmvak dlddrcddmhvinn aktm s  it    ias vs  avvsqhlkdrernhc elvgqeiat  lsdqsd 
              a   g                                     g    a    k         

       250       260       270       280       290    
....:....|....:....|....:....|....:....|....:....|....
: .:..*: *.*:*         .. **  .. * ..  ::*  :*: :     
iqsqggWdrFaEiFgvdaaa--rrsqESsvkwlLvgvtlvtGv-vGtllaqkrr
liknna ng v f hr----ev-qdp  ikrnt lamigls -vi stimmfiq
               m    ds    fi    a f a  l  a f k  l
© 1998-2019