Dataset for protein Mcl-1 of organism Saimiri boliviensis boliviensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
************************************                                            
MFGLQRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLaaekeasaqrevgggeagaviggsagasppaaltpdarrvvrpp
                                    --------------------------------------------

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
pigaevpdvtatpsrllffaptrraapleemeapaadaimspedeldgyepeplgkrpavlpllelvgepghgsstdgsl
--------------------------------------------------------------------------------

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                             ***************************************** :  :     
pstpppaeeeedelyrqsleiisrylreqATGAKDTKPMGRSGAASRKALETLRRVGDGVQRNHETAFQGmlrkldikne
-----------------------------                                         wvcgv-----

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
            : . *  .*                     ::.*   :. .           *   .*.* *: : : 
ddvkslsrvmvhvfsdGvtnWgrivtlisfgafvakhlktinqesCieplaesitdvlvrtkrdWlvkqRgWdGfveffh
------------lpcr srr ---------------------hqk aagfcrcc---------- ---s s f isnkia

       330       340       350
....:....|....:....|....:....|
:                             
vedleggirnvllafagvagvgaglaylir
l-----------------------------
© 1998-2019