Dataset for protein BCL-2-like of organism Saimiri boliviensis boliviensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------t-----dtrnlvadylgyklyqkgygtg-----ag-g------------------------------
hlsslpliaarmm-dhsfpyihlqtqafirlv-ripqsvl-pfsdv--s-gatppgtrsemlapgakstqpgwtegpaap
          maaapaeagmfga-rn-vv--n qcg-a-csq    eepvegaaaagdp  ettsiinsn mtrssdssa
            h grtsq-n-ei--k--s - --- -s-d       nrtep e aal       fdrk ahppaapp 
               pmqys-e-  v   h   s r  ew        d                 c ge  ghl     
                lg r  q  m   e                                                  
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                   . ..                                         
----------------------------sklhqalraagdevekryrrafspllgqlh-vtpgnartrfsqvmeelfrd-
vnpvtrtxxxxxxxxxxxxxxxxxspvpdptsrvmqkvafsfqtgveetlkdcadsvgiismdtrqqs-t--vdke-qgs
rdgaaghsssldarevipm         gr-lateketsaqrsvefgtsgavmgana-haynpsdykiv-rms---le- 
                            -av--mw r  lvprrngpsrwrgivs--l -k ra vg-let -nhv -  
                            t-ikl   q   r  llli f qeytrkmd l  fd lel a  ava  s  
                            rveae       g    h  d  apsp       e                 
                            p a         d            r                          
                            a                                                   
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       .:*    : . :                                        :           :    .   
-g-pnwgRiVaffafggalc------------------kesvnkemeplvd---riaewmaeylntrladwirenggwaa
p-ivdarnv tipvieaiviergplvtarwkkwgfqsrvkllreriavdigtykqvsyfvvafimnntgeplqsseapd-
  vit   l rpls a em-                  a--------scct   etqsrlttvaerhrra  hrqr  -e
   t      mlip   v l                  -hepdrnvqr  s   alpasilfr vdtkep  ekm   et
             e   t a                  l  ktidqs   q   p vll ss  pgqhht  vd    vs
                 f                        eg      e   n  g   d           a    gn
                                                                               l
                                                                               k
                                                                               g

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------fve---lygpeal-e----qpl-e---------l-g----ga----------------
daimspedeldwetpkrwglqn---kqmg-enspag-splvr--f-gnwasvrtv-v-avgv--stdgslpstpppaeee
trvktwvrmstensealkeiflltl   -t-dn--ekrrkglrrrnvmvlnsswlytletalrsl              l
gfrrkrgpkmg mg        ema   vnv-gmqamakaa-eylprwivtlmsifsvvpihagv               
e   af g ge da         l    nmsv-lgnlklvsmyiedksfrdgllhal nldy  t               
                       c    mlhlpdemagdtkgsg  fge  akif g ma i  f               
                            ffdklc k e mi             a a d     c               
                               ei                                               
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------g--f--k---------------------------------------------------------
edelyrcgsvqslvil-aylss-atgakdtkpmgrsgaasrkaletlrrvgdgvqrnhetafqgwltqvdiknedivkst
 ahfhg    nrvetvssl-rrqpk fayiefsdkesvrtsl  deslfr rqikvdfkafiyssvrkl      dp rl
             tlicrfyaerl                                        m cg            
             k f pk pih                                                         
             i   la lh                                                          
                 d  gg                                                          
                     a                                                          
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
srvmvsvtsrgvtrwgrivtlisfgafvryrlrttnyqscrsrfyssitsvpvrtvyrwrvrsrswygpynkihvedleg
n pgihtpdd srna             akhak i qnksieplcrgfndrlrgrkrdglakqtg fsiveffal     
      lfc  fp                       he  aag aecc              a   d fs          
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       490       500    
....:....|....:....|....
                        
------------------------
girnvllafagvagvgaglaylir
                        
                        
                        
                        
                        
                        
                        
© 1998-2019