Dataset for protein Bcl-w of organism Saimiri boliviensis boliviensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
           *********************************************************************
-----------MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLH
hlsslpliaar                                                                     

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
***************************************************************************  *  
VTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWa-Eft
                                                                           el ai

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
        *** .*.*               ** ..*            *:: .* *  ** .                 
alygdgalEEArrLrE---------------GNwasV------------RtvltGaValGAlvt----------------
karvreme   ek k lqnevekqmnmsppp  agp imsieekmeada siyv n dy  taeeleahfhgcgsvnrvt

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
ilcdkfsghpkgfayiefsdkesvrtslaldeslfrgrqikvdfkafiyssltqvipkrtnrpgisttdrgfpraryrar

       330       340       350       
....:....|....:....|....:....|....:..
                             . ::::. 
-----------------------------vgaffask
ttnynssrsrfysgfnsrprgrvyrgraratswyspy
© 1998-2019