Dataset for protein Bcl-xL of organism Saimiri boliviensis boliviensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                                        *: :.  . :*             
msqsnrelvvdflsyklsqkgyswsqfsdveenrteapegtdsemetpsaingnpa hladlpaqk aighsssldarev

        90       100       110       120       130       140       150       160
                     **  . :.* *************************************************
ipmaaikqalreagdefelry  afpdlp m                                                 

       170       180       190       200       210       220       230   
© 1998-2019