Dataset for protein Bfl1 of organism Saimiri boliviensis boliviensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MTDHEFGYIHNLTQDYLRYVLQIPQSGTGPSKTSRVLQKVAFSVQKEVEESLKPCLDNVHIVSMDNARTIFSQVMEKEFE
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
************************************************************                    
DGIINWGRIVTIFAFEGILIKKLLRERIAPDVDTYKEISYFVAEFIMNNTGEWIRRNGGW-------------w------
                                                            gngfvkkfepksg-ntlmlv
                                                            ek            msflem

       170     
....:....|....:
          :    
---------llsq--
tvkscqmlskmklyy
lgeiaekkkd a   
© 1998-2019