Dataset for protein BCL-2-like of organism Rhinopithecus roxellana

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------dnr-lvadylgyk----lsq-gy------------------------------------------------
mattgrsgp---e----fi---rnav---k--swsqgsvgaetrgaapepgtfssqpgptpipgnsswpvvrtspvpgpt
 mmpdaeayytyaiavkmfsfv    irlrl e dafddveanptet ag ielemethsahnaaprdhladspalntaa
  hapctsqsrnrvlql--qc      q n    ggagl  gsg    p  rlartgakdtk mgrmgkttgltletr s
  d lmmfgki   im n h       g                       cc ae            ars kr qk   
  a   frte     g   y                                                     a      
        f                                                                       
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--vcgagpgegp--a-plhqalraagdeferryrrtfsdl----asqlhvtpgtarqrftqvveelfrdgv-nwgrivaf
gp-aa-----s-ga-dvv---mlsvqkdvstnfepalgemlgypgt-nvlsafssyts-e-------qg-pi----l-t-
ahs--pdsrp-s vst--qlvafqte--lrllrkiggdnv    -avigi-idadqp-l-t snke -- -tt   - -l
t issl lalvk tprapkkt--e--araqk l tdvasa    t-r--evnlm pgl sr mdhv sp i     v si
  cpqv a a i pmp  ggr  - a g na h sc qgy    srkveak ed vkv nd  v   e            
  ag         g a       r      q w  p pa     lnh d-     ea  a                    
  e                                f                                            
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    . :                    .                                                    
fsfggalc------------------vesvnkemqplvg---riaewmaeylnthledwiqsnggwdtf-----------
-v--avmtkreplvtawwkkrsfqpraklrrqqrevdidtykqvqa--vt--errvapvthesarllf-aptrraaplee
v- e ivieh                pdaldvaia-pcs   ----fvtafi-dntrt lrtqr  eet ika vrem  
ie a t l                  l tqer vsr- q   nlsysl--v mnekpe  gqp   asm           
 a   f a                  k ei g sp   e   e vllissr vathha  vd    vng           
 t                                c       p      d  tgq g    k    rle           
                                                             a    gk            
                                                                   g            
                                                                   a            

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
meapaadaimspeeeldgyepeplgkrpavlpllelvgesgnssstdgslpstpppaeeeedelyrcgsvqsleiisryl
   eklkelqnev kqmnms p gnag vimsie kmeadar iyvgnv  dygat   l ahfhg    nrvt lcdkf
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
reqatgakdtkpmgrsgatsrkaletlrrvgdgvqrnhetafqgwvrkvdikneddvkslsrvmvhvpsrgvtrwgrivt
sghpk fayiefsdkesvrtsl  d              sl r rqigl                 lfcd prn      
                                            mlc                                 
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------velyg------s-kr-lr--rw------------------------------------t-m-vag-vvlgvlf
lisfgaf-----nnagae-r--qe-rn--flstvqyrtsrswlvktrgwggpvmlvnvslrtvll-g-tl--vit-sssl
       takrtvtdarleeagp-pfsnylarstnvpskagrfe qadpdffgeffhnrvllgitnava-gflglv-aga
       rrtplrrpnqstcmkrfgeggta  llldnl  df                efkgpgsgvlpmtak--nplf-
       ipfhhkgi iqpviegrfkht r  d                         ddeel rrnil syalfem--r
       f  f  e  haktdaf cdfs m                                  ili e   s ca ryp
       c           s    a ci h                                  d h     c    ipn
                   g      ac c                                    f           ah
                                                                                

       
....:..
       
grk----
ssaylir
alvlrsl
kkqkmag
lql c  
 id    
 h     
 c     
       
© 1998-2019