Dataset for protein Bcl-w of organism Rhinopithecus roxellana

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MATPASAPDTRALVADFLGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
****************************************************************  *          ***
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWa-EftalygdgalEEA
                                                                el aikarvreme   

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 .*.*               ** ..*            *:: .* *  ** .                            
rrLrE---------------GNwasV------------RtvltGaValGAlvtv--------------------------
ek k lqnevekqmnmsppp  agp imsieekmeada siyv n dy  taeeleahfhgcgsvnrvtilcdkfsghpk

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                            * .:
----------------------------------------------------------------------------Gaff
gfayiefsdkesvrtslaldeslfrgrqikvipkrtnrpgisttdrgfpraryrarttnynssrsrfysgfnsrpr rvy

   
...
 * 
aSk
r g
© 1998-2019