Dataset for protein BCL-2-like of organism Rhinopithecus bieti

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------ia--l------lvadylgykl-------------------------------------------------
mmfpfkrnav-gln-ycggar-gqgsgqatprqkgylwtekeasarreiggpeagtvigesagtsppaaltpdwrrvarp
 atgasapdtr-dcefgynygia--fv--v-pggrlvasqgsvveetrteagap iftsspmhapsainsrdsakltssr
  d lrertamtgrtsysire -vk--sc-as r  s dafddg anpga   g   seqege  h   gn pvh  gpl
        m v  pmrqrte  lm  ih c      e                                   m a  dl 
          h    ged                                                              
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
ppigaevpdvtgtparllffaptrraapleemeapaadaimspeeeldgyepeplgkrpavlpllelvgesgnssstdgs
avp                                                                             
 tn                                                                             
 qk                                                                             
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                            .                   
------------------------------atgapgtgps-r------kalqtlrrvgdgvqrrhrrafsgmlsqlhvtp
lpstpppaeeeedelyrqsleiisrylreqqipgkdsk-mg-sgatsr-vheamqqa--efetnfettlqdlarnv---s
                              ggaq--e-laadevppvaptsrv--k-af-lskeyfknykpc-dk-nikn
                              ca--hs-s -tspaivm sl---  a   s nlsv spvpsyva- dla-
                              e-ttaepr dlp    l a-klr  -   d h  w pd lewt-h     
                               p   aa             aa   e             a  stg     
                                                                         c      
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                  .    *                                              .         
-gtavqsftqvmeelfsdG--vnWGRiVaffsFggalckes-------vnkemeplv-------------iaewmaeyln
iesdrtrlsr-vvkvprgsvgpt --l-tliv-eaivivklktinawwqrsciqv--dtykedvardcqrlsasvttviv
 dd-ykl-n-msnhelqr p tr   - -i-a --f-aah-plvt   lerqfagdlsrqeg        vqyfivsf-m
 --rq--vet -d-  e  i i    v s-v- a -m---e       kdqsas r gq           fvrllwd- e
 fn -g  al a-a  c    r         t   v ler        hq       kn            clccsar -
     e  -                      e   t             k        e                    t
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     *:                                                                         
rhlrdWiqsngGWd--------------------------------------gfve-f---------r------------
tttgp lvqqr--eleftklyvrgmleearrlrelqnevekqmnmspppgnw----l-gvedlegsr-gqerfnfswlsl
nrkee frks-  -  aiaargdeae   ek k                  ntsckfyhpnaaaegik rpl d      
dn-at  he-   g                                     kap imsrnssplafw             
--hhs  --    a                                     a   hk itpmm  da             
gq  a   d                                                 eekk                  
        a                                                    f                  
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-wlltlatvggvvtllayl-r-----------------------------------------------------------
rvftggvl-aalgeggslfs-kclsvnrvtilcdkfsghpkgfayiefsdkesvrtslaldeslfrgrqikvipkrtnrp
n---afmgy--itlv----khymgl                                                       
ktyv-a--tcltsasvghritrla                                                        
tlmns-pvl kcinmieahwqg                                                          
sihiqnfma   c kf   gk                                                           
g   hmed    a e    f                                                            
    f  a      a                                                                 

       490       500       510       520    
....:....|....:....|....:....|....:....|....
                                            
--------------------------------------------
gisttdrgfpraryrarttnynssrsrfysgfnsrprgrvyrsk
                                      affa g
                                            
                                            
                                            
                                            
                                            
© 1998-2019